Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319EIJ7

Protein Details
Accession A0A319EIJ7    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
19-44SAPRVPRACVRCRKRKLKASRHGIGPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, cyto 4.5, pero 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
CDD cd00067  GAL4  
Amino Acid Sequences MQAPRLPGEASDLEQAKGSAPRVPRACVRCRKRKLKASRHGIGPAYDQQDETFDHRLDETLGSFGQTFFNLTSSDPLTAWTWGSRAYMHQSDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.18
4 0.19
5 0.18
6 0.17
7 0.18
8 0.25
9 0.27
10 0.3
11 0.35
12 0.39
13 0.47
14 0.53
15 0.6
16 0.63
17 0.71
18 0.78
19 0.81
20 0.85
21 0.87
22 0.87
23 0.88
24 0.87
25 0.82
26 0.75
27 0.69
28 0.6
29 0.49
30 0.41
31 0.35
32 0.28
33 0.23
34 0.2
35 0.16
36 0.16
37 0.16
38 0.16
39 0.15
40 0.13
41 0.13
42 0.13
43 0.13
44 0.13
45 0.12
46 0.1
47 0.08
48 0.08
49 0.08
50 0.08
51 0.08
52 0.08
53 0.08
54 0.08
55 0.07
56 0.09
57 0.09
58 0.09
59 0.12
60 0.12
61 0.13
62 0.12
63 0.14
64 0.14
65 0.15
66 0.15
67 0.13
68 0.13
69 0.13
70 0.14
71 0.13
72 0.16
73 0.23