Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319DUN4

Protein Details
Accession A0A319DUN4    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
68-94QATHTREKSDKTKRQRGKKDVWPSEDMHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 11.5, nucl 10.5, mito 8, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MSTVNIVKYFFYRGSEIHKTTSMNGMHQIDPLGYHVTLCFKDEQQLLRGTHVSSHGYVKDQDNLEFIQATHTREKSDKTKRQRGKKDVWPSEDMLVQAPDIGYSHLPPN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.34
3 0.35
4 0.34
5 0.35
6 0.33
7 0.33
8 0.38
9 0.31
10 0.25
11 0.29
12 0.29
13 0.26
14 0.26
15 0.24
16 0.17
17 0.16
18 0.16
19 0.13
20 0.09
21 0.09
22 0.09
23 0.12
24 0.12
25 0.13
26 0.13
27 0.11
28 0.15
29 0.17
30 0.18
31 0.18
32 0.24
33 0.23
34 0.23
35 0.23
36 0.19
37 0.18
38 0.18
39 0.17
40 0.12
41 0.13
42 0.12
43 0.13
44 0.14
45 0.14
46 0.17
47 0.17
48 0.16
49 0.16
50 0.15
51 0.14
52 0.13
53 0.12
54 0.13
55 0.14
56 0.16
57 0.2
58 0.2
59 0.22
60 0.23
61 0.28
62 0.33
63 0.42
64 0.49
65 0.54
66 0.65
67 0.72
68 0.81
69 0.87
70 0.86
71 0.85
72 0.86
73 0.87
74 0.84
75 0.81
76 0.74
77 0.66
78 0.59
79 0.51
80 0.41
81 0.32
82 0.24
83 0.18
84 0.15
85 0.12
86 0.1
87 0.09
88 0.1
89 0.09