Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8NI85

Protein Details
Accession A8NI85   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
244-264PTPQAERRRAGKHTKRVIVRTHydrophilic
NLS Segment(s)
PositionSequence
249-259ERRRAGKHTKR
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
KEGG cci:CC1G_01611  -  
Amino Acid Sequences MATFPLRPAMSPSPSPTASTSTPDDQNPSYKTSSTVRSSPPGNPNVNGRARRPLSPNFLRDVDLTNSNDGQPRKYPAPPTGHDLMAMFPPAPPDNFPELRAGPTSGYFVRQERAFFAQAGKEIVRVRVEVDLPPGSGNSRQWQPPSAPSGPASASQSPHISSSSAPVPYPHHANRPLQRHSLPNNVVPLFPLSTNHPHSHPGLPSNLHAHQNGPDSRTPPRDASFNAKGDYSPEDPDEEAWRRPTPQAERRRAGKHTKRVIVRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.42
3 0.37
4 0.36
5 0.32
6 0.33
7 0.34
8 0.32
9 0.35
10 0.34
11 0.37
12 0.34
13 0.38
14 0.36
15 0.36
16 0.33
17 0.3
18 0.32
19 0.32
20 0.37
21 0.35
22 0.38
23 0.38
24 0.4
25 0.43
26 0.47
27 0.5
28 0.51
29 0.49
30 0.46
31 0.47
32 0.51
33 0.56
34 0.52
35 0.47
36 0.49
37 0.48
38 0.51
39 0.51
40 0.5
41 0.51
42 0.55
43 0.55
44 0.5
45 0.48
46 0.45
47 0.4
48 0.37
49 0.31
50 0.28
51 0.27
52 0.24
53 0.24
54 0.23
55 0.27
56 0.24
57 0.24
58 0.22
59 0.26
60 0.28
61 0.31
62 0.34
63 0.36
64 0.43
65 0.42
66 0.44
67 0.42
68 0.38
69 0.34
70 0.31
71 0.25
72 0.18
73 0.17
74 0.1
75 0.07
76 0.1
77 0.1
78 0.1
79 0.1
80 0.14
81 0.19
82 0.2
83 0.21
84 0.22
85 0.22
86 0.23
87 0.23
88 0.19
89 0.14
90 0.14
91 0.15
92 0.12
93 0.13
94 0.13
95 0.13
96 0.15
97 0.16
98 0.16
99 0.16
100 0.19
101 0.18
102 0.17
103 0.17
104 0.15
105 0.15
106 0.16
107 0.14
108 0.13
109 0.12
110 0.13
111 0.13
112 0.12
113 0.12
114 0.12
115 0.13
116 0.11
117 0.13
118 0.11
119 0.11
120 0.11
121 0.1
122 0.09
123 0.1
124 0.11
125 0.11
126 0.14
127 0.16
128 0.17
129 0.19
130 0.19
131 0.22
132 0.27
133 0.24
134 0.23
135 0.22
136 0.22
137 0.21
138 0.21
139 0.21
140 0.17
141 0.16
142 0.17
143 0.17
144 0.16
145 0.16
146 0.15
147 0.12
148 0.1
149 0.12
150 0.14
151 0.14
152 0.13
153 0.14
154 0.17
155 0.19
156 0.25
157 0.25
158 0.28
159 0.32
160 0.39
161 0.45
162 0.49
163 0.51
164 0.5
165 0.5
166 0.5
167 0.51
168 0.53
169 0.48
170 0.44
171 0.44
172 0.4
173 0.37
174 0.31
175 0.28
176 0.2
177 0.17
178 0.16
179 0.15
180 0.21
181 0.26
182 0.27
183 0.26
184 0.28
185 0.31
186 0.34
187 0.32
188 0.29
189 0.28
190 0.27
191 0.28
192 0.31
193 0.32
194 0.3
195 0.28
196 0.27
197 0.27
198 0.32
199 0.32
200 0.31
201 0.3
202 0.3
203 0.35
204 0.39
205 0.39
206 0.36
207 0.36
208 0.37
209 0.37
210 0.43
211 0.45
212 0.43
213 0.4
214 0.36
215 0.34
216 0.32
217 0.34
218 0.28
219 0.23
220 0.21
221 0.21
222 0.21
223 0.23
224 0.28
225 0.27
226 0.28
227 0.3
228 0.31
229 0.32
230 0.35
231 0.42
232 0.45
233 0.51
234 0.58
235 0.63
236 0.69
237 0.74
238 0.78
239 0.77
240 0.79
241 0.79
242 0.79
243 0.79
244 0.8