Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319E4V9

Protein Details
Accession A0A319E4V9   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
127-165DGEGGKPKPKPQPQPQPNSDCAHKHCKKNKDCVNYRDCHHydrophilic
NLS Segment(s)
PositionSequence
102-137KGGHSGGGHGGGHGGAGKGGGKGGHDGEGGKPKPKP
Subcellular Location(s) extr 23, E.R. 2
Family & Domain DBs
Amino Acid Sequences MLCSACLLALPFTLVTADGATTRYLEPVPETIPVLDTHDQLIEMATLHPNGTLDDRDGGYYLINEKDEVLAVASDELCVALDQSMESALQMHSRDNLLAARKGGHSGGGHGGGHGGAGKGGGKGGHDGEGGKPKPKPQPQPQPNSDCAHKHCKKNKDCVNYRDCHACSTKDHWCM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.07
4 0.07
5 0.07
6 0.08
7 0.08
8 0.1
9 0.1
10 0.11
11 0.11
12 0.11
13 0.12
14 0.14
15 0.15
16 0.14
17 0.15
18 0.14
19 0.15
20 0.14
21 0.18
22 0.17
23 0.16
24 0.16
25 0.15
26 0.15
27 0.13
28 0.13
29 0.08
30 0.07
31 0.07
32 0.07
33 0.07
34 0.07
35 0.08
36 0.07
37 0.08
38 0.09
39 0.09
40 0.09
41 0.11
42 0.11
43 0.11
44 0.11
45 0.11
46 0.09
47 0.09
48 0.09
49 0.09
50 0.09
51 0.08
52 0.08
53 0.08
54 0.08
55 0.08
56 0.06
57 0.05
58 0.04
59 0.05
60 0.04
61 0.04
62 0.04
63 0.04
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.04
72 0.03
73 0.03
74 0.04
75 0.04
76 0.06
77 0.07
78 0.07
79 0.07
80 0.08
81 0.08
82 0.08
83 0.1
84 0.11
85 0.12
86 0.12
87 0.13
88 0.13
89 0.14
90 0.13
91 0.13
92 0.11
93 0.11
94 0.12
95 0.12
96 0.12
97 0.11
98 0.11
99 0.08
100 0.08
101 0.07
102 0.05
103 0.03
104 0.04
105 0.04
106 0.04
107 0.05
108 0.05
109 0.05
110 0.07
111 0.08
112 0.09
113 0.09
114 0.1
115 0.13
116 0.21
117 0.22
118 0.25
119 0.26
120 0.31
121 0.4
122 0.48
123 0.55
124 0.57
125 0.67
126 0.73
127 0.82
128 0.84
129 0.82
130 0.78
131 0.73
132 0.67
133 0.62
134 0.58
135 0.59
136 0.57
137 0.61
138 0.65
139 0.7
140 0.73
141 0.78
142 0.82
143 0.82
144 0.84
145 0.84
146 0.84
147 0.77
148 0.73
149 0.72
150 0.63
151 0.58
152 0.52
153 0.46
154 0.42
155 0.45