Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319EH04

Protein Details
Accession A0A319EH04    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
88-107YSGTGSKRGKKSKPPLHSAGHydrophilic
478-501EVDPGRKERKQTWRRVQDDNDDNEAcidic
NLS Segment(s)
PositionSequence
93-103SKRGKKSKPPL
Subcellular Location(s) nucl 15.5, cyto_nucl 11.833, cyto 7, cyto_mito 5.833, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039128  TRIP4-like  
IPR009349  Znf_C2HC5  
Gene Ontology GO:0005634  C:nucleus  
GO:0008270  F:zinc ion binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF06221  zf-C2HC5  
Amino Acid Sequences MSNPGLISWGVPRLAQLLPLDEESLTQIITYAASLPKEEGADHLKNLLGDSPAAFEFIAAFSSRREPPRSSAPSPAPDRASATPKNNYSGTGSKRGKKSKPPLHSAGPVRRPDNFGNVTGGYRKEDQDEDYMPVSSRSRQDAGTRTGPSPLMSSREASAPSSRNQSPAPRPTPAKNPPSAAGPVISDLLPNVKSKAAKSASRTGGSTATGSSSKGSLTTNNISDLTAAIAALEVSTNPTLSGGARKCTCYASIHPLFDPAPNCLNCGKIICSLEGLQPCSFCGTPLLSNDEIQSMIRELRAERGQEKMRAHNEGVHREGGPGPGLGAPSKLDAAKAHRDKLLAFQAQNAKRTRVVDEAADFETPNVASTLWMTPAQRALALKKQQRIMREMEEKARPEWEKKKTIMSLDIKGGKVRRVYQSAGPAEAGPSAEEEAEAKAEEELGDGHGDSSGKAFSHNPLLAAGGLLRPVWKSAEGEEVDPGRKERKQTWRRVQDDNDDNEQWILDGGLHGHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.2
3 0.18
4 0.18
5 0.19
6 0.21
7 0.21
8 0.18
9 0.18
10 0.17
11 0.16
12 0.12
13 0.09
14 0.09
15 0.08
16 0.08
17 0.08
18 0.09
19 0.11
20 0.12
21 0.13
22 0.14
23 0.16
24 0.16
25 0.16
26 0.17
27 0.22
28 0.24
29 0.24
30 0.24
31 0.23
32 0.23
33 0.23
34 0.22
35 0.15
36 0.13
37 0.13
38 0.14
39 0.13
40 0.13
41 0.12
42 0.1
43 0.1
44 0.09
45 0.1
46 0.08
47 0.09
48 0.1
49 0.15
50 0.21
51 0.26
52 0.31
53 0.33
54 0.38
55 0.48
56 0.55
57 0.53
58 0.56
59 0.57
60 0.6
61 0.62
62 0.62
63 0.54
64 0.47
65 0.48
66 0.44
67 0.45
68 0.43
69 0.44
70 0.46
71 0.46
72 0.49
73 0.44
74 0.42
75 0.4
76 0.41
77 0.41
78 0.44
79 0.48
80 0.51
81 0.59
82 0.67
83 0.69
84 0.72
85 0.77
86 0.77
87 0.8
88 0.8
89 0.78
90 0.75
91 0.76
92 0.74
93 0.73
94 0.71
95 0.67
96 0.61
97 0.58
98 0.57
99 0.5
100 0.5
101 0.43
102 0.36
103 0.34
104 0.32
105 0.31
106 0.29
107 0.28
108 0.22
109 0.22
110 0.22
111 0.21
112 0.22
113 0.23
114 0.24
115 0.25
116 0.25
117 0.23
118 0.23
119 0.2
120 0.21
121 0.19
122 0.19
123 0.2
124 0.22
125 0.22
126 0.23
127 0.29
128 0.33
129 0.37
130 0.4
131 0.39
132 0.36
133 0.36
134 0.35
135 0.3
136 0.26
137 0.21
138 0.19
139 0.18
140 0.18
141 0.17
142 0.19
143 0.19
144 0.19
145 0.22
146 0.2
147 0.22
148 0.27
149 0.27
150 0.28
151 0.29
152 0.35
153 0.38
154 0.45
155 0.46
156 0.45
157 0.49
158 0.5
159 0.57
160 0.58
161 0.57
162 0.51
163 0.49
164 0.45
165 0.45
166 0.42
167 0.32
168 0.24
169 0.18
170 0.15
171 0.14
172 0.12
173 0.09
174 0.07
175 0.09
176 0.09
177 0.1
178 0.1
179 0.12
180 0.13
181 0.14
182 0.22
183 0.24
184 0.27
185 0.31
186 0.39
187 0.41
188 0.41
189 0.41
190 0.34
191 0.31
192 0.28
193 0.23
194 0.14
195 0.12
196 0.11
197 0.11
198 0.1
199 0.09
200 0.08
201 0.08
202 0.09
203 0.09
204 0.13
205 0.16
206 0.16
207 0.17
208 0.17
209 0.16
210 0.16
211 0.14
212 0.1
213 0.07
214 0.06
215 0.04
216 0.04
217 0.03
218 0.03
219 0.03
220 0.02
221 0.04
222 0.04
223 0.04
224 0.04
225 0.04
226 0.05
227 0.05
228 0.12
229 0.11
230 0.15
231 0.16
232 0.18
233 0.19
234 0.19
235 0.2
236 0.17
237 0.19
238 0.24
239 0.26
240 0.26
241 0.25
242 0.26
243 0.25
244 0.24
245 0.22
246 0.15
247 0.17
248 0.16
249 0.18
250 0.16
251 0.17
252 0.15
253 0.15
254 0.15
255 0.13
256 0.14
257 0.13
258 0.13
259 0.14
260 0.16
261 0.17
262 0.18
263 0.15
264 0.14
265 0.14
266 0.15
267 0.14
268 0.1
269 0.1
270 0.09
271 0.1
272 0.12
273 0.16
274 0.15
275 0.15
276 0.15
277 0.14
278 0.13
279 0.12
280 0.11
281 0.07
282 0.07
283 0.07
284 0.08
285 0.08
286 0.12
287 0.15
288 0.17
289 0.17
290 0.23
291 0.26
292 0.31
293 0.33
294 0.35
295 0.35
296 0.37
297 0.36
298 0.35
299 0.37
300 0.36
301 0.35
302 0.3
303 0.27
304 0.24
305 0.25
306 0.2
307 0.16
308 0.11
309 0.09
310 0.09
311 0.09
312 0.08
313 0.08
314 0.07
315 0.08
316 0.09
317 0.08
318 0.08
319 0.1
320 0.15
321 0.24
322 0.28
323 0.29
324 0.3
325 0.31
326 0.3
327 0.34
328 0.37
329 0.31
330 0.27
331 0.3
332 0.38
333 0.4
334 0.46
335 0.43
336 0.37
337 0.36
338 0.38
339 0.35
340 0.3
341 0.28
342 0.25
343 0.24
344 0.24
345 0.22
346 0.21
347 0.18
348 0.14
349 0.14
350 0.11
351 0.1
352 0.08
353 0.06
354 0.06
355 0.08
356 0.09
357 0.1
358 0.12
359 0.12
360 0.13
361 0.15
362 0.15
363 0.15
364 0.16
365 0.18
366 0.25
367 0.33
368 0.38
369 0.41
370 0.47
371 0.48
372 0.5
373 0.5
374 0.47
375 0.47
376 0.49
377 0.47
378 0.47
379 0.5
380 0.48
381 0.45
382 0.47
383 0.41
384 0.42
385 0.48
386 0.49
387 0.51
388 0.51
389 0.58
390 0.55
391 0.56
392 0.57
393 0.53
394 0.49
395 0.49
396 0.51
397 0.44
398 0.44
399 0.43
400 0.38
401 0.37
402 0.39
403 0.39
404 0.38
405 0.41
406 0.42
407 0.49
408 0.46
409 0.43
410 0.38
411 0.31
412 0.27
413 0.25
414 0.2
415 0.11
416 0.1
417 0.09
418 0.08
419 0.08
420 0.08
421 0.08
422 0.09
423 0.09
424 0.08
425 0.07
426 0.08
427 0.07
428 0.07
429 0.07
430 0.07
431 0.07
432 0.07
433 0.07
434 0.08
435 0.09
436 0.08
437 0.09
438 0.09
439 0.09
440 0.11
441 0.12
442 0.14
443 0.22
444 0.23
445 0.22
446 0.21
447 0.22
448 0.2
449 0.19
450 0.17
451 0.09
452 0.09
453 0.09
454 0.09
455 0.09
456 0.1
457 0.12
458 0.13
459 0.14
460 0.15
461 0.24
462 0.24
463 0.25
464 0.28
465 0.3
466 0.31
467 0.31
468 0.32
469 0.3
470 0.32
471 0.37
472 0.41
473 0.49
474 0.57
475 0.66
476 0.75
477 0.79
478 0.81
479 0.85
480 0.82
481 0.81
482 0.8
483 0.76
484 0.71
485 0.62
486 0.57
487 0.48
488 0.41
489 0.3
490 0.21
491 0.15
492 0.08
493 0.08