Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319F6I8

Protein Details
Accession A0A319F6I8    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
70-98ISQWHGKEDMKKRRRRRKNGTHNDNQPGMBasic
107-128TIYHPYTYIHKSKRRRKKEETDBasic
NLS Segment(s)
PositionSequence
79-88MKKRRRRRKN
117-124KSKRRRKK
Subcellular Location(s) nucl 11.5, mito_nucl 11.5, mito 10.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039744  40S_S29/30S_S14z  
IPR001209  Ribosomal_S14  
IPR043140  Ribosomal_S14/S29  
IPR018271  Ribosomal_S14_CS  
IPR023676  Ribosomal_S14_type-Z_arc  
Gene Ontology GO:0015935  C:small ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0008270  F:zinc ion binding  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00253  Ribosomal_S14  
PROSITE View protein in PROSITE  
PS00527  RIBOSOMAL_S14  
Amino Acid Sequences MTHESVWYSRPRKFGKGSRGCRVCTHRAGLIRKYGMNICRQCFREKSQDIGFHKVGLTITITHHHYYIIISQWHGKEDMKKRRRRRKNGTHNDNQPGMPISEKESGTIYHPYTYIHKSKRRRKKEETD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.65
3 0.71
4 0.75
5 0.77
6 0.77
7 0.72
8 0.71
9 0.69
10 0.65
11 0.59
12 0.54
13 0.48
14 0.51
15 0.54
16 0.5
17 0.49
18 0.45
19 0.4
20 0.39
21 0.39
22 0.35
23 0.38
24 0.39
25 0.35
26 0.39
27 0.4
28 0.42
29 0.41
30 0.43
31 0.44
32 0.41
33 0.44
34 0.43
35 0.48
36 0.47
37 0.49
38 0.45
39 0.35
40 0.33
41 0.29
42 0.23
43 0.15
44 0.13
45 0.08
46 0.08
47 0.1
48 0.13
49 0.12
50 0.12
51 0.11
52 0.11
53 0.1
54 0.11
55 0.11
56 0.1
57 0.1
58 0.13
59 0.14
60 0.15
61 0.15
62 0.15
63 0.21
64 0.3
65 0.41
66 0.46
67 0.56
68 0.66
69 0.76
70 0.85
71 0.88
72 0.9
73 0.9
74 0.92
75 0.95
76 0.94
77 0.92
78 0.9
79 0.85
80 0.76
81 0.64
82 0.54
83 0.44
84 0.35
85 0.27
86 0.19
87 0.18
88 0.2
89 0.21
90 0.2
91 0.19
92 0.19
93 0.21
94 0.26
95 0.22
96 0.19
97 0.19
98 0.2
99 0.24
100 0.3
101 0.36
102 0.4
103 0.48
104 0.57
105 0.68
106 0.77
107 0.83
108 0.87