Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319EQQ8

Protein Details
Accession A0A319EQQ8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MNREKRKQRWIDSKTLRKDATHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, cyto 9, mito_nucl 9
Family & Domain DBs
Amino Acid Sequences MNREKRKQRWIDSKTLRKDATLLALLDAEDPDDASAVFLLVSKRYMSYVNKATQSTFKPDRVSNVTADDDKPLKKASNPAADPSGVVAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.81
3 0.71
4 0.61
5 0.56
6 0.47
7 0.41
8 0.34
9 0.26
10 0.18
11 0.18
12 0.17
13 0.15
14 0.13
15 0.08
16 0.05
17 0.05
18 0.04
19 0.04
20 0.04
21 0.03
22 0.03
23 0.03
24 0.03
25 0.04
26 0.05
27 0.05
28 0.06
29 0.06
30 0.07
31 0.07
32 0.11
33 0.11
34 0.16
35 0.22
36 0.25
37 0.27
38 0.28
39 0.28
40 0.3
41 0.3
42 0.33
43 0.32
44 0.31
45 0.32
46 0.33
47 0.37
48 0.38
49 0.38
50 0.32
51 0.31
52 0.31
53 0.29
54 0.29
55 0.27
56 0.25
57 0.23
58 0.24
59 0.23
60 0.22
61 0.24
62 0.32
63 0.36
64 0.43
65 0.44
66 0.47
67 0.47
68 0.45
69 0.42