Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319F1L7

Protein Details
Accession A0A319F1L7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGRRSRQACKRPRREEAARMPVGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MGRRSRQACKRPRREEAARMPVGELAAACGDKTGKLPHRLSGGPYRSRLSPHGKSNLLDIPWK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.82
4 0.81
5 0.71
6 0.62
7 0.54
8 0.46
9 0.38
10 0.28
11 0.17
12 0.08
13 0.07
14 0.06
15 0.05
16 0.05
17 0.05
18 0.05
19 0.06
20 0.11
21 0.16
22 0.23
23 0.25
24 0.27
25 0.31
26 0.32
27 0.35
28 0.38
29 0.4
30 0.38
31 0.4
32 0.39
33 0.37
34 0.39
35 0.41
36 0.41
37 0.42
38 0.45
39 0.5
40 0.51
41 0.5
42 0.52
43 0.51