Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A8N8W8

Protein Details
Accession A8N8W8    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
53-78ATKSKKPSPTWKRPFNSRKTMPKPWLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 9.333, mito_nucl 8.499, nucl 8, mito 7.5, cyto 7.5
Family & Domain DBs
KEGG cci:CC1G_00843  -  
Amino Acid Sequences MISSCSSSNPISGSSLERMASPTRSPSTRNNWPIHPCPPPISSRLVALPVCSATKSKKPSPTWKRPFNSRKTMPKPWLHLWLQVALVLSRRMKQRNNGVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.19
4 0.18
5 0.19
6 0.2
7 0.21
8 0.19
9 0.22
10 0.24
11 0.26
12 0.29
13 0.34
14 0.4
15 0.47
16 0.54
17 0.52
18 0.54
19 0.59
20 0.6
21 0.58
22 0.53
23 0.45
24 0.41
25 0.4
26 0.36
27 0.31
28 0.31
29 0.26
30 0.23
31 0.21
32 0.2
33 0.18
34 0.16
35 0.14
36 0.11
37 0.1
38 0.1
39 0.1
40 0.1
41 0.17
42 0.22
43 0.27
44 0.35
45 0.42
46 0.52
47 0.62
48 0.7
49 0.73
50 0.78
51 0.77
52 0.79
53 0.83
54 0.8
55 0.8
56 0.78
57 0.79
58 0.77
59 0.82
60 0.79
61 0.76
62 0.75
63 0.69
64 0.69
65 0.6
66 0.56
67 0.49
68 0.43
69 0.36
70 0.3
71 0.27
72 0.19
73 0.19
74 0.19
75 0.18
76 0.21
77 0.28
78 0.34
79 0.39
80 0.48