Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319FL58

Protein Details
Accession A0A319FL58   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
35-58SRLNRAFGKKTQKRRKAIPPGLSEHydrophilic
217-240DGPAKPQAAQHPKKNRSQGRWFGGHydrophilic
NLS Segment(s)
PositionSequence
42-51GKKTQKRRKA
Subcellular Location(s) cyto 9, mito 7, cyto_nucl 7, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025187  DUF4112  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF13430  DUF4112  
Amino Acid Sequences MSAQLASLVGKKILGETARNHFGQEDPYFEEVPASRLNRAFGKKTQKRRKAIPPGLSENDSKVLTQVKRRAYRLDLCLFSLCGIRFGWGSVIGLFPFIGDGADAALALMVVHTCDKIDGGLPSRLRMMMLMNIVIDFFIGLVPFIGDVADAVYKCNTRNAVLLEKHLRQKGAKALGRQERRHDVEDMSLPDEFDRYDEDASGEPSRHKGQSHSRNTDGPAKPQAAQHPKKNRSQGRWFGGGAQREEDLERGVVDNAQSSRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.24
4 0.31
5 0.36
6 0.36
7 0.35
8 0.32
9 0.31
10 0.33
11 0.29
12 0.25
13 0.24
14 0.27
15 0.27
16 0.26
17 0.27
18 0.21
19 0.22
20 0.24
21 0.22
22 0.23
23 0.23
24 0.26
25 0.31
26 0.36
27 0.38
28 0.4
29 0.5
30 0.55
31 0.65
32 0.74
33 0.76
34 0.78
35 0.82
36 0.86
37 0.86
38 0.86
39 0.83
40 0.8
41 0.78
42 0.75
43 0.68
44 0.58
45 0.49
46 0.43
47 0.34
48 0.26
49 0.2
50 0.23
51 0.23
52 0.3
53 0.35
54 0.41
55 0.47
56 0.5
57 0.53
58 0.52
59 0.56
60 0.55
61 0.54
62 0.46
63 0.41
64 0.39
65 0.35
66 0.29
67 0.26
68 0.19
69 0.14
70 0.13
71 0.12
72 0.11
73 0.11
74 0.11
75 0.08
76 0.09
77 0.07
78 0.08
79 0.07
80 0.07
81 0.06
82 0.05
83 0.05
84 0.04
85 0.04
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.02
92 0.02
93 0.02
94 0.02
95 0.02
96 0.02
97 0.02
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.04
104 0.05
105 0.06
106 0.09
107 0.13
108 0.14
109 0.14
110 0.15
111 0.14
112 0.13
113 0.12
114 0.1
115 0.08
116 0.08
117 0.08
118 0.07
119 0.07
120 0.07
121 0.06
122 0.05
123 0.03
124 0.02
125 0.02
126 0.02
127 0.02
128 0.02
129 0.02
130 0.02
131 0.02
132 0.02
133 0.02
134 0.02
135 0.03
136 0.04
137 0.04
138 0.05
139 0.06
140 0.07
141 0.08
142 0.11
143 0.11
144 0.11
145 0.14
146 0.17
147 0.23
148 0.23
149 0.28
150 0.3
151 0.34
152 0.38
153 0.37
154 0.36
155 0.3
156 0.33
157 0.35
158 0.39
159 0.38
160 0.36
161 0.43
162 0.51
163 0.58
164 0.58
165 0.57
166 0.56
167 0.57
168 0.56
169 0.5
170 0.42
171 0.37
172 0.38
173 0.33
174 0.26
175 0.22
176 0.19
177 0.17
178 0.16
179 0.12
180 0.09
181 0.1
182 0.1
183 0.1
184 0.11
185 0.12
186 0.12
187 0.16
188 0.17
189 0.15
190 0.14
191 0.18
192 0.22
193 0.23
194 0.23
195 0.27
196 0.36
197 0.46
198 0.55
199 0.58
200 0.58
201 0.59
202 0.62
203 0.65
204 0.57
205 0.52
206 0.48
207 0.43
208 0.42
209 0.42
210 0.49
211 0.5
212 0.55
213 0.59
214 0.63
215 0.68
216 0.74
217 0.8
218 0.8
219 0.78
220 0.81
221 0.81
222 0.77
223 0.75
224 0.67
225 0.64
226 0.61
227 0.57
228 0.49
229 0.41
230 0.35
231 0.31
232 0.31
233 0.25
234 0.2
235 0.15
236 0.14
237 0.13
238 0.13
239 0.13
240 0.13
241 0.17