Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8N016

Protein Details
Accession A8N016   
Localization Confidence High
Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
82-110DYDSWNKKYKDARKKKDKEGEKKAKEKMDBasic
NLS Segment(s)
PositionSequence
88-108KKYKDARKKKDKEGEKKAKEK
137-150MAKKRSPSPPRKRK
Subcellular Location(s) nucl 20, cyto_nucl 11.5, pero 3
Family & Domain DBs
KEGG cci:CC1G_02786  -  
Amino Acid Sequences MASTVVAWDPYDDYLDARSLDFYDTYDARGFYDDDFVLSARDLARLDIRASDISHVLVIRADPNAAAECKKFTDAYNATKKDYDSWNKKYKDARKKKDKEGEKKAKEKMDELREYVEYNREEMEIWCAKANNPGSPMAKKRSPSPPRKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.13
4 0.12
5 0.12
6 0.11
7 0.12
8 0.12
9 0.11
10 0.14
11 0.14
12 0.16
13 0.17
14 0.16
15 0.15
16 0.17
17 0.16
18 0.12
19 0.16
20 0.13
21 0.12
22 0.12
23 0.11
24 0.1
25 0.1
26 0.1
27 0.07
28 0.09
29 0.08
30 0.09
31 0.11
32 0.12
33 0.12
34 0.12
35 0.13
36 0.13
37 0.13
38 0.13
39 0.12
40 0.1
41 0.11
42 0.1
43 0.08
44 0.07
45 0.07
46 0.07
47 0.06
48 0.06
49 0.05
50 0.06
51 0.07
52 0.08
53 0.08
54 0.08
55 0.09
56 0.1
57 0.11
58 0.11
59 0.1
60 0.18
61 0.2
62 0.27
63 0.34
64 0.35
65 0.35
66 0.36
67 0.36
68 0.31
69 0.34
70 0.37
71 0.36
72 0.43
73 0.51
74 0.51
75 0.56
76 0.61
77 0.64
78 0.66
79 0.69
80 0.72
81 0.74
82 0.81
83 0.86
84 0.87
85 0.87
86 0.87
87 0.87
88 0.87
89 0.85
90 0.85
91 0.81
92 0.76
93 0.68
94 0.62
95 0.6
96 0.58
97 0.53
98 0.47
99 0.43
100 0.39
101 0.38
102 0.35
103 0.32
104 0.24
105 0.21
106 0.2
107 0.17
108 0.17
109 0.16
110 0.21
111 0.18
112 0.19
113 0.2
114 0.2
115 0.2
116 0.27
117 0.29
118 0.27
119 0.26
120 0.31
121 0.33
122 0.39
123 0.45
124 0.45
125 0.48
126 0.47
127 0.52
128 0.58
129 0.64
130 0.68