Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319EQK5

Protein Details
Accession A0A319EQK5    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
80-106DDENGRREKKEKEKGKREKENRVMFDVBasic
NLS Segment(s)
PositionSequence
85-98RREKKEKEKGKREK
Subcellular Location(s) mito 20, cyto 4, nucl 2, cyto_pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFRNPSLHLLPCWTSPSQARPPAPAAPVHIYFTFHLSPTLLISNIPWLAVMYLFDCFLGGLFCSSFSMNGMGATETEAVDDENGRREKKEKEKGKREKENRVMFDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.34
4 0.37
5 0.43
6 0.42
7 0.42
8 0.45
9 0.46
10 0.44
11 0.37
12 0.33
13 0.3
14 0.3
15 0.29
16 0.26
17 0.24
18 0.22
19 0.25
20 0.21
21 0.16
22 0.15
23 0.13
24 0.12
25 0.12
26 0.12
27 0.08
28 0.08
29 0.07
30 0.09
31 0.09
32 0.08
33 0.07
34 0.06
35 0.06
36 0.06
37 0.06
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.03
47 0.03
48 0.03
49 0.04
50 0.05
51 0.05
52 0.05
53 0.06
54 0.07
55 0.06
56 0.06
57 0.07
58 0.06
59 0.06
60 0.07
61 0.07
62 0.06
63 0.06
64 0.06
65 0.06
66 0.06
67 0.08
68 0.07
69 0.14
70 0.18
71 0.19
72 0.21
73 0.25
74 0.34
75 0.44
76 0.54
77 0.57
78 0.65
79 0.75
80 0.84
81 0.91
82 0.93
83 0.91
84 0.92
85 0.91
86 0.9