Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319F3V3

Protein Details
Accession A0A319F3V3   
Localization Confidence Low
Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
65-84LRVTGKKRHQKKYYTHNTRPBasic
NLS Segment(s)
Subcellular Location(s) mito 12.5, mito_nucl 11.833, nucl 10, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR005822  Ribosomal_L13  
IPR005823  Ribosomal_L13_bac-type  
IPR036899  Ribosomal_L13_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00572  Ribosomal_L13  
CDD cd00392  Ribosomal_L13  
Amino Acid Sequences MSSTVGKSRLGFSRTWHYVDVGSDSRSLGRVASSIALTLMGKNKPIYDPSTDCGDYVVAVGCHDLRVTGKKRHQKKYYTHNTRPGSLRSMTMDKMFEKWGGGEVLRRAVRGMLPKNRLRDKRLARLKTFEGLAHPYKENIVKINGQSVIGNLPEVKEAFKAAKSETSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.43
3 0.39
4 0.33
5 0.32
6 0.33
7 0.33
8 0.25
9 0.23
10 0.2
11 0.2
12 0.19
13 0.18
14 0.17
15 0.12
16 0.1
17 0.09
18 0.09
19 0.1
20 0.1
21 0.09
22 0.08
23 0.09
24 0.08
25 0.1
26 0.14
27 0.13
28 0.15
29 0.15
30 0.17
31 0.18
32 0.2
33 0.21
34 0.23
35 0.25
36 0.25
37 0.31
38 0.3
39 0.28
40 0.25
41 0.22
42 0.16
43 0.13
44 0.12
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.05
51 0.05
52 0.06
53 0.13
54 0.19
55 0.26
56 0.34
57 0.42
58 0.52
59 0.62
60 0.68
61 0.69
62 0.72
63 0.75
64 0.79
65 0.8
66 0.77
67 0.77
68 0.71
69 0.67
70 0.62
71 0.53
72 0.45
73 0.35
74 0.3
75 0.23
76 0.24
77 0.21
78 0.19
79 0.19
80 0.15
81 0.16
82 0.16
83 0.14
84 0.11
85 0.11
86 0.11
87 0.1
88 0.1
89 0.1
90 0.1
91 0.16
92 0.16
93 0.16
94 0.15
95 0.15
96 0.17
97 0.23
98 0.29
99 0.31
100 0.38
101 0.42
102 0.5
103 0.59
104 0.61
105 0.6
106 0.62
107 0.62
108 0.66
109 0.72
110 0.72
111 0.66
112 0.67
113 0.64
114 0.57
115 0.51
116 0.41
117 0.34
118 0.32
119 0.32
120 0.29
121 0.27
122 0.24
123 0.26
124 0.28
125 0.27
126 0.24
127 0.24
128 0.25
129 0.26
130 0.3
131 0.28
132 0.25
133 0.24
134 0.21
135 0.2
136 0.16
137 0.16
138 0.11
139 0.11
140 0.13
141 0.13
142 0.13
143 0.12
144 0.14
145 0.16
146 0.18
147 0.2
148 0.2