Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D1BVX0

Protein Details
Accession A0A0D1BVX0    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
218-241LRPFLVRQDKKRHYLRADRPSLKDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 8.5, cyto_nucl 5.5, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039848  Ribosomal_S24/S35  
IPR019349  Ribosomal_S24/S35_mit  
Gene Ontology GO:0005763  C:mitochondrial small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG uma:UMAG_05890  -  
Pfam View protein in Pfam  
PF10213  MRP-S28  
Amino Acid Sequences MSLVTNLGSSLRTATSSISIASGPSCSSTAARAFSISVRVNAKPRKQRNADDPMSLRRMPKFNYDDVPSLGHQILQRKRELLKVMRTVEFEIPKLAKFRQAYTPPKPEQCLQFRFQHYQGENHPASRKVVLTVNVDELVKVGAVKDTPSKHKLLLLAGSRFHPKSNAAAKQGEGVIKISCELFPNERQNMKWCSDTLDALVKEANVRTKEVDDLPLDLRPFLVRQDKKRHYLRADRPSLKDFPKEWL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.14
4 0.14
5 0.13
6 0.12
7 0.12
8 0.12
9 0.11
10 0.09
11 0.1
12 0.1
13 0.11
14 0.11
15 0.14
16 0.17
17 0.18
18 0.18
19 0.17
20 0.18
21 0.18
22 0.24
23 0.22
24 0.23
25 0.24
26 0.27
27 0.35
28 0.42
29 0.5
30 0.54
31 0.61
32 0.67
33 0.71
34 0.76
35 0.77
36 0.79
37 0.73
38 0.69
39 0.64
40 0.6
41 0.58
42 0.52
43 0.46
44 0.41
45 0.42
46 0.37
47 0.42
48 0.41
49 0.39
50 0.42
51 0.43
52 0.4
53 0.37
54 0.37
55 0.28
56 0.27
57 0.23
58 0.2
59 0.19
60 0.25
61 0.29
62 0.3
63 0.31
64 0.31
65 0.33
66 0.35
67 0.39
68 0.37
69 0.39
70 0.43
71 0.45
72 0.44
73 0.44
74 0.42
75 0.4
76 0.35
77 0.28
78 0.24
79 0.21
80 0.2
81 0.21
82 0.19
83 0.2
84 0.2
85 0.22
86 0.28
87 0.35
88 0.42
89 0.47
90 0.55
91 0.52
92 0.54
93 0.54
94 0.48
95 0.47
96 0.47
97 0.44
98 0.39
99 0.42
100 0.43
101 0.44
102 0.43
103 0.42
104 0.36
105 0.35
106 0.33
107 0.34
108 0.31
109 0.29
110 0.29
111 0.24
112 0.24
113 0.21
114 0.19
115 0.13
116 0.16
117 0.17
118 0.18
119 0.17
120 0.18
121 0.17
122 0.17
123 0.15
124 0.12
125 0.09
126 0.06
127 0.05
128 0.04
129 0.04
130 0.04
131 0.06
132 0.1
133 0.13
134 0.19
135 0.22
136 0.23
137 0.23
138 0.25
139 0.26
140 0.23
141 0.26
142 0.25
143 0.25
144 0.24
145 0.26
146 0.28
147 0.26
148 0.25
149 0.21
150 0.18
151 0.23
152 0.3
153 0.33
154 0.33
155 0.34
156 0.34
157 0.34
158 0.34
159 0.28
160 0.2
161 0.16
162 0.13
163 0.11
164 0.12
165 0.1
166 0.09
167 0.1
168 0.12
169 0.14
170 0.21
171 0.28
172 0.32
173 0.34
174 0.35
175 0.4
176 0.42
177 0.41
178 0.37
179 0.3
180 0.31
181 0.3
182 0.29
183 0.25
184 0.28
185 0.25
186 0.24
187 0.24
188 0.18
189 0.18
190 0.2
191 0.24
192 0.18
193 0.2
194 0.21
195 0.22
196 0.26
197 0.25
198 0.27
199 0.22
200 0.23
201 0.23
202 0.25
203 0.24
204 0.2
205 0.19
206 0.16
207 0.16
208 0.19
209 0.28
210 0.32
211 0.41
212 0.52
213 0.6
214 0.68
215 0.75
216 0.79
217 0.77
218 0.81
219 0.82
220 0.82
221 0.85
222 0.83
223 0.8
224 0.76
225 0.75
226 0.69
227 0.66