Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319EIW5

Protein Details
Accession A0A319EIW5    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
71-92NEEEKKHKNRWGPSRLRHGSRVBasic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MLAPRALAPHAPRRLSFFFRRPSSAIYPSLRRLCIFSSLLQTLPALLRSIKLHGEDGRRKESRIMQSAECNEEEKKHKNRWGPSRLRHGSRVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.51
3 0.53
4 0.51
5 0.53
6 0.55
7 0.58
8 0.53
9 0.53
10 0.51
11 0.48
12 0.45
13 0.41
14 0.41
15 0.43
16 0.45
17 0.4
18 0.35
19 0.33
20 0.28
21 0.29
22 0.26
23 0.2
24 0.21
25 0.21
26 0.2
27 0.19
28 0.17
29 0.13
30 0.11
31 0.1
32 0.07
33 0.06
34 0.07
35 0.07
36 0.09
37 0.1
38 0.11
39 0.12
40 0.16
41 0.24
42 0.29
43 0.33
44 0.39
45 0.39
46 0.39
47 0.41
48 0.45
49 0.45
50 0.45
51 0.45
52 0.39
53 0.44
54 0.47
55 0.45
56 0.38
57 0.32
58 0.27
59 0.28
60 0.32
61 0.35
62 0.4
63 0.45
64 0.52
65 0.58
66 0.67
67 0.72
68 0.77
69 0.78
70 0.79
71 0.82
72 0.84
73 0.81