Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319ELH2

Protein Details
Accession A0A319ELH2    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-31DPKLVTDKRSRRFLPKKRYRKVLRNNIDGIHydrophilic
NLS Segment(s)
PositionSequence
9-26KRSRRFLPKKRYRKVLRN
37-38RR
Subcellular Location(s) nucl 13.5, cyto_nucl 11, cyto 7.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR001951  Histone_H4  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Amino Acid Sequences MDPKLVTDKRSRRFLPKKRYRKVLRNNIDGITRPAIRRLARRGGVVRISAGIYAEVRVALKARLTEILRQVVHILDSSTTPGHERKVVTTRDVIFALNRMGHTLYGFNTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.82
4 0.85
5 0.85
6 0.91
7 0.9
8 0.9
9 0.91
10 0.9
11 0.88
12 0.84
13 0.78
14 0.69
15 0.62
16 0.53
17 0.45
18 0.38
19 0.31
20 0.25
21 0.24
22 0.28
23 0.28
24 0.33
25 0.35
26 0.39
27 0.39
28 0.42
29 0.42
30 0.4
31 0.39
32 0.34
33 0.28
34 0.2
35 0.18
36 0.14
37 0.12
38 0.08
39 0.06
40 0.06
41 0.05
42 0.05
43 0.04
44 0.05
45 0.05
46 0.05
47 0.06
48 0.06
49 0.07
50 0.11
51 0.12
52 0.15
53 0.18
54 0.23
55 0.22
56 0.22
57 0.22
58 0.18
59 0.17
60 0.14
61 0.11
62 0.07
63 0.07
64 0.09
65 0.08
66 0.08
67 0.1
68 0.12
69 0.13
70 0.17
71 0.17
72 0.21
73 0.29
74 0.31
75 0.31
76 0.36
77 0.35
78 0.35
79 0.34
80 0.29
81 0.23
82 0.23
83 0.22
84 0.19
85 0.17
86 0.16
87 0.16
88 0.16
89 0.16
90 0.16