FuNGI

A0A319E558

Protein Details

Accession

A0A319E558

Localization Confidence

High

Confidence Score

20.1

NoLS Segment(s)

Position	Sequence	Protein Nature
549-578	MAGARKRPANKDNRVTKRVRQSRLPKDYDP	Hydrophilic
586-614	RWLPLRDRSSYRPKGRKGKQRAAERTQGG	Hydrophilic

NLS Segment(s)

Position	Sequence
553-570	RKRPANKDNRVTKRVRQS
592-608	DRSSYRPKGRKGKQRAA
636-648	GGASSKKKKKGKR

Subcellular Location(s)

nucl 23, cyto_nucl 14.5

Family & Domain DBs

InterPro	View protein in InterPro IPR013699 Signal_recog_part_SRP72_RNA-bd IPR026270 SRP72 IPR031545 SRP_TPR-like IPR011990 TPR-like_helical_dom_sf
Gene Ontology	GO:0005783 C:endoplasmic reticulum GO:0005786 C:signal recognition particle, endoplasmic reticulum targeting GO:0008312 F:7S RNA binding GO:0006614 P:SRP-dependent cotranslational protein targeting to membrane
Pfam	View protein in Pfam PF08492 SRP72 PF17004 SRP_TPR_like

Amino Acid Sequences

MATQSLSSLLQRASIDDHEEVLQSSNAALAKSKSDLHAQHAKAVALLKLDRYDDCLRVFEEAGDGLKKRAALEYAYALYKCGQLEPAIEVVSRLAGERGALHLEAQASYRSEKFRRAAELYEELSKGETSLYNEDNDLRINSWATDAQLQWKGYPEFVRHNRPTRDDLEAFETVYNAACLSIAKGEFQQGEVLLKRAKELCRTSEDLSPEDRAAELLPIAVQQLYVLLRQGKSEEAQSVLEEISVGDIPELSTRKIAQTNITLARGTTTNPFALYKALHETPDSADSDKLFEYQDNIATGNSHSADLLVQKYDGIIRSTSKALAQAAYPSTEPHVNLLSVYNAAAHGRGETGTKALKSILAALDKRPKDLGLALTAVQLYVSAGNTTSAITTLERTLQLLDESISEQDKEVRFNPGLLSILVSLYKLEGRKVQIRGELAKAATYWQSQAEPPASLLRAAGASLLHSFDRSDLVTAGDLFKSLYQKDTNDQYAVAGYVASQATLDYSKVQAQVDSLPSVADLISGVNVASLESAGISPSSSANAAAAAAMAGARKRPANKDNRVTKRVRQSRLPKDYDPSKTADPERWLPLRDRSSYRPKGRKGKQRAAERTQGGVVHEKAEESAAAPSQPQKSQGGGASSKKKKKGKR

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.21
2	0.25
3	0.22
4	0.24
5	0.21
6	0.21
7	0.2
8	0.18
9	0.16
10	0.12
11	0.11
12	0.12
13	0.13
14	0.12
15	0.14
16	0.13
17	0.16
18	0.18
19	0.21
20	0.2
21	0.27
22	0.29
23	0.34
24	0.42
25	0.4
26	0.44
27	0.44
28	0.42
29	0.36
30	0.36
31	0.3
32	0.25
33	0.25
34	0.21
35	0.21
36	0.23
37	0.21
38	0.26
39	0.29
40	0.28
41	0.29
42	0.29
43	0.27
44	0.27
45	0.28
46	0.21
47	0.18
48	0.16
49	0.16
50	0.17
51	0.17
52	0.15
53	0.16
54	0.17
55	0.16
56	0.18
57	0.18
58	0.16
59	0.19
60	0.22
61	0.23
62	0.25
63	0.24
64	0.22
65	0.21
66	0.22
67	0.2
68	0.16
69	0.15
70	0.13
71	0.15
72	0.16
73	0.17
74	0.15
75	0.14
76	0.13
77	0.12
78	0.12
79	0.1
80	0.09
81	0.07
82	0.07
83	0.07
84	0.08
85	0.09
86	0.11
87	0.11
88	0.1
89	0.12
90	0.13
91	0.13
92	0.13
93	0.13
94	0.13
95	0.15
96	0.19
97	0.23
98	0.25
99	0.32
100	0.34
101	0.37
102	0.42
103	0.43
104	0.43
105	0.42
106	0.45
107	0.4
108	0.4
109	0.35
110	0.28
111	0.26
112	0.23
113	0.17
114	0.13
115	0.13
116	0.12
117	0.17
118	0.18
119	0.18
120	0.19
121	0.2
122	0.19
123	0.19
124	0.17
125	0.13
126	0.13
127	0.13
128	0.13
129	0.13
130	0.13
131	0.13
132	0.15
133	0.15
134	0.19
135	0.24
136	0.24
137	0.23
138	0.27
139	0.26
140	0.26
141	0.29
142	0.27
143	0.32
144	0.38
145	0.48
146	0.5
147	0.58
148	0.61
149	0.62
150	0.64
151	0.57
152	0.57
153	0.48
154	0.43
155	0.4
156	0.35
157	0.31
158	0.26
159	0.23
160	0.15
161	0.14
162	0.12
163	0.06
164	0.05
165	0.05
166	0.05
167	0.05
168	0.08
169	0.08
170	0.09
171	0.09
172	0.13
173	0.13
174	0.13
175	0.13
176	0.11
177	0.14
178	0.13
179	0.16
180	0.15
181	0.14
182	0.16
183	0.2
184	0.22
185	0.27
186	0.3
187	0.32
188	0.35
189	0.4
190	0.4
191	0.39
192	0.39
193	0.33
194	0.32
195	0.3
196	0.24
197	0.2
198	0.17
199	0.13
200	0.11
201	0.09
202	0.07
203	0.05
204	0.05
205	0.05
206	0.05
207	0.05
208	0.04
209	0.04
210	0.05
211	0.06
212	0.06
213	0.08
214	0.1
215	0.1
216	0.11
217	0.12
218	0.12
219	0.12
220	0.14
221	0.13
222	0.12
223	0.12
224	0.12
225	0.12
226	0.1
227	0.09
228	0.08
229	0.06
230	0.06
231	0.05
232	0.05
233	0.04
234	0.04
235	0.04
236	0.08
237	0.09
238	0.08
239	0.09
240	0.1
241	0.13
242	0.16
243	0.17
244	0.17
245	0.18
246	0.23
247	0.24
248	0.25
249	0.22
250	0.19
251	0.19
252	0.17
253	0.15
254	0.13
255	0.12
256	0.11
257	0.12
258	0.13
259	0.12
260	0.13
261	0.12
262	0.11
263	0.13
264	0.14
265	0.14
266	0.13
267	0.14
268	0.14
269	0.17
270	0.16
271	0.13
272	0.12
273	0.12
274	0.13
275	0.12
276	0.11
277	0.09
278	0.08
279	0.1
280	0.1
281	0.11
282	0.1
283	0.11
284	0.1
285	0.1
286	0.1
287	0.09
288	0.09
289	0.07
290	0.07
291	0.06
292	0.07
293	0.08
294	0.08
295	0.07
296	0.06
297	0.06
298	0.06
299	0.07
300	0.08
301	0.08
302	0.08
303	0.09
304	0.1
305	0.11
306	0.12
307	0.11
308	0.11
309	0.11
310	0.1
311	0.1
312	0.1
313	0.1
314	0.1
315	0.1
316	0.09
317	0.1
318	0.1
319	0.1
320	0.09
321	0.1
322	0.09
323	0.09
324	0.09
325	0.08
326	0.07
327	0.07
328	0.06
329	0.05
330	0.05
331	0.05
332	0.05
333	0.04
334	0.05
335	0.05
336	0.06
337	0.06
338	0.07
339	0.09
340	0.09
341	0.09
342	0.09
343	0.09
344	0.08
345	0.1
346	0.11
347	0.13
348	0.14
349	0.17
350	0.25
351	0.25
352	0.25
353	0.24
354	0.22
355	0.19
356	0.2
357	0.18
358	0.12
359	0.13
360	0.12
361	0.12
362	0.12
363	0.11
364	0.08
365	0.07
366	0.05
367	0.05
368	0.04
369	0.04
370	0.04
371	0.05
372	0.05
373	0.05
374	0.05
375	0.05
376	0.05
377	0.06
378	0.07
379	0.07
380	0.08
381	0.08
382	0.09
383	0.09
384	0.09
385	0.08
386	0.08
387	0.07
388	0.07
389	0.07
390	0.08
391	0.08
392	0.07
393	0.08
394	0.12
395	0.12
396	0.14
397	0.15
398	0.19
399	0.18
400	0.19
401	0.19
402	0.16
403	0.16
404	0.14
405	0.13
406	0.09
407	0.09
408	0.08
409	0.08
410	0.06
411	0.06
412	0.09
413	0.08
414	0.09
415	0.13
416	0.17
417	0.24
418	0.27
419	0.29
420	0.3
421	0.33
422	0.34
423	0.32
424	0.31
425	0.24
426	0.22
427	0.19
428	0.17
429	0.16
430	0.14
431	0.13
432	0.11
433	0.13
434	0.12
435	0.16
436	0.16
437	0.14
438	0.14
439	0.16
440	0.15
441	0.14
442	0.13
443	0.11
444	0.09
445	0.09
446	0.08
447	0.05
448	0.06
449	0.07
450	0.08
451	0.07
452	0.08
453	0.08
454	0.08
455	0.1
456	0.09
457	0.09
458	0.08
459	0.09
460	0.1
461	0.1
462	0.11
463	0.09
464	0.09
465	0.08
466	0.1
467	0.12
468	0.12
469	0.15
470	0.16
471	0.18
472	0.23
473	0.29
474	0.29
475	0.27
476	0.27
477	0.23
478	0.21
479	0.2
480	0.15
481	0.09
482	0.06
483	0.08
484	0.08
485	0.07
486	0.07
487	0.06
488	0.08
489	0.09
490	0.09
491	0.07
492	0.09
493	0.12
494	0.15
495	0.15
496	0.14
497	0.15
498	0.18
499	0.19
500	0.18
501	0.16
502	0.13
503	0.12
504	0.13
505	0.11
506	0.07
507	0.05
508	0.04
509	0.04
510	0.05
511	0.04
512	0.04
513	0.04
514	0.04
515	0.04
516	0.04
517	0.04
518	0.04
519	0.04
520	0.04
521	0.04
522	0.05
523	0.05
524	0.06
525	0.07
526	0.07
527	0.07
528	0.07
529	0.07
530	0.07
531	0.06
532	0.06
533	0.04
534	0.04
535	0.04
536	0.05
537	0.06
538	0.07
539	0.1
540	0.14
541	0.19
542	0.27
543	0.37
544	0.46
545	0.56
546	0.64
547	0.73
548	0.79
549	0.82
550	0.8
551	0.79
552	0.8
553	0.8
554	0.76
555	0.75
556	0.76
557	0.79
558	0.84
559	0.82
560	0.75
561	0.74
562	0.76
563	0.73
564	0.65
565	0.59
566	0.53
567	0.53
568	0.53
569	0.5
570	0.48
571	0.46
572	0.5
573	0.49
574	0.48
575	0.46
576	0.52
577	0.52
578	0.52
579	0.53
580	0.54
581	0.61
582	0.69
583	0.75
584	0.75
585	0.78
586	0.83
587	0.87
588	0.89
589	0.89
590	0.89
591	0.87
592	0.89
593	0.89
594	0.86
595	0.85
596	0.77
597	0.7
598	0.62
599	0.55
600	0.47
601	0.43
602	0.37
603	0.3
604	0.27
605	0.24
606	0.21
607	0.2
608	0.17
609	0.12
610	0.13
611	0.12
612	0.12
613	0.14
614	0.2
615	0.24
616	0.26
617	0.28
618	0.28
619	0.29
620	0.33
621	0.35
622	0.36
623	0.37
624	0.44
625	0.51
626	0.58
627	0.65
628	0.7

A0A319E558

3D AlphaFold-predicted Structure Viewer