Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A319E1R1

Protein Details
Accession A0A319E1R1    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
40-64QARPCSFTPVKRPRKRKYDPSGMTDHydrophilic
NLS Segment(s)
PositionSequence
52-55PRKR
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences MSAEIQGSEPLHKACDACRARKTRCKLSGSADACEFCLSQARPCSFTPVKRPRKRKYDPSGMTDPNYRMRRANLSPQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.24
3 0.27
4 0.32
5 0.39
6 0.46
7 0.53
8 0.61
9 0.67
10 0.67
11 0.7
12 0.69
13 0.64
14 0.62
15 0.64
16 0.58
17 0.52
18 0.43
19 0.34
20 0.3
21 0.27
22 0.21
23 0.11
24 0.13
25 0.12
26 0.13
27 0.18
28 0.19
29 0.21
30 0.22
31 0.3
32 0.28
33 0.32
34 0.4
35 0.46
36 0.56
37 0.62
38 0.73
39 0.74
40 0.81
41 0.86
42 0.86
43 0.85
44 0.86
45 0.82
46 0.79
47 0.78
48 0.71
49 0.64
50 0.59
51 0.52
52 0.5
53 0.48
54 0.43
55 0.38
56 0.39
57 0.45
58 0.46