Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319DU73

Protein Details
Accession A0A319DU73   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
9-34AAAPSGVKKRSQKQKKTKTAAPAPAPHydrophilic
NLS Segment(s)
PositionSequence
4-43KKKSVAAAPSGVKKRSQKQKKTKTAAPAPAPAPAPAVRPP
Subcellular Location(s) nucl 15, mito 10
Family & Domain DBs
Amino Acid Sequences MASKKKSVAAAPSGVKKRSQKQKKTKTAAPAPAPAPAPAVRPPPPSRAELAAAEGQKAGVSVPEGLLPAPRVLTPGQLLRRQELKTEVETKKQAERRLREEKKAIKEQLNAVCTAHQASVLSLQKSIRELKTLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.52
3 0.53
4 0.58
5 0.63
6 0.68
7 0.7
8 0.76
9 0.85
10 0.89
11 0.9
12 0.87
13 0.86
14 0.84
15 0.82
16 0.75
17 0.7
18 0.59
19 0.55
20 0.49
21 0.39
22 0.32
23 0.24
24 0.23
25 0.2
26 0.25
27 0.24
28 0.3
29 0.33
30 0.35
31 0.37
32 0.36
33 0.35
34 0.32
35 0.31
36 0.25
37 0.25
38 0.23
39 0.2
40 0.19
41 0.16
42 0.13
43 0.11
44 0.1
45 0.07
46 0.04
47 0.04
48 0.04
49 0.04
50 0.05
51 0.05
52 0.05
53 0.06
54 0.06
55 0.06
56 0.06
57 0.05
58 0.07
59 0.07
60 0.08
61 0.09
62 0.14
63 0.18
64 0.21
65 0.22
66 0.23
67 0.29
68 0.28
69 0.28
70 0.28
71 0.26
72 0.27
73 0.35
74 0.34
75 0.34
76 0.37
77 0.37
78 0.41
79 0.43
80 0.47
81 0.47
82 0.52
83 0.55
84 0.63
85 0.67
86 0.66
87 0.7
88 0.71
89 0.71
90 0.74
91 0.71
92 0.66
93 0.64
94 0.64
95 0.62
96 0.55
97 0.47
98 0.38
99 0.33
100 0.28
101 0.26
102 0.18
103 0.12
104 0.11
105 0.11
106 0.18
107 0.22
108 0.22
109 0.22
110 0.23
111 0.25
112 0.28
113 0.34
114 0.27