Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A8NFI0

Protein Details
Accession A8NFI0    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
123-148RLQQRHEKRGEKLRRLRSLRWRKLFABasic
NLS Segment(s)
PositionSequence
127-145RHEKRGEKLRRLRSLRWRK
Subcellular Location(s) mito 16, nucl 8, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cci:CC1G_04268  -  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences MFAQLSRNVVANALACRRSVTPRFSFFQPSILPATARLYSTPVNNLEQTRNVLESVTRNLPETDYEKRWADMSAIARHSAQKNPPAGPYDGRKVTVQKGKGVADAMRALDSILTRNKVRQQLRLQQRHEKRGEKLRRLRSLRWRKLFANEVRSHRLFSFTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.22
4 0.24
5 0.3
6 0.34
7 0.37
8 0.39
9 0.43
10 0.47
11 0.48
12 0.52
13 0.44
14 0.44
15 0.37
16 0.33
17 0.32
18 0.28
19 0.26
20 0.2
21 0.23
22 0.19
23 0.19
24 0.16
25 0.16
26 0.17
27 0.18
28 0.21
29 0.2
30 0.21
31 0.23
32 0.25
33 0.24
34 0.25
35 0.26
36 0.23
37 0.21
38 0.19
39 0.16
40 0.15
41 0.15
42 0.17
43 0.18
44 0.17
45 0.17
46 0.17
47 0.18
48 0.19
49 0.2
50 0.21
51 0.21
52 0.24
53 0.23
54 0.23
55 0.23
56 0.21
57 0.18
58 0.17
59 0.18
60 0.19
61 0.19
62 0.19
63 0.19
64 0.22
65 0.23
66 0.22
67 0.21
68 0.22
69 0.24
70 0.24
71 0.26
72 0.26
73 0.25
74 0.25
75 0.26
76 0.26
77 0.24
78 0.25
79 0.24
80 0.24
81 0.29
82 0.32
83 0.3
84 0.28
85 0.31
86 0.3
87 0.3
88 0.29
89 0.23
90 0.19
91 0.19
92 0.16
93 0.12
94 0.11
95 0.1
96 0.09
97 0.09
98 0.1
99 0.12
100 0.15
101 0.16
102 0.2
103 0.26
104 0.34
105 0.37
106 0.43
107 0.48
108 0.55
109 0.65
110 0.71
111 0.71
112 0.73
113 0.78
114 0.79
115 0.78
116 0.74
117 0.71
118 0.72
119 0.77
120 0.77
121 0.78
122 0.78
123 0.81
124 0.81
125 0.83
126 0.83
127 0.84
128 0.84
129 0.84
130 0.8
131 0.73
132 0.74
133 0.75
134 0.72
135 0.71
136 0.67
137 0.66
138 0.68
139 0.66
140 0.61
141 0.52