Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319EDE2

Protein Details
Accession A0A319EDE2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
57-79GETNLATRTRHRRRRSPTFYYVEHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 15, plas 4, mito 3, golg 2, pero 1, E.R. 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MALVYNLFYACNDADCLNSISGGGIAGIVLGAIAGTLLILWLFRLCSIGSGGESDYGETNLATRTRHRRRRSPTFYYVEKPRGEVRRPAKVYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.15
4 0.13
5 0.12
6 0.11
7 0.1
8 0.09
9 0.08
10 0.06
11 0.03
12 0.03
13 0.03
14 0.03
15 0.02
16 0.02
17 0.02
18 0.01
19 0.01
20 0.01
21 0.01
22 0.01
23 0.01
24 0.01
25 0.02
26 0.02
27 0.02
28 0.02
29 0.03
30 0.03
31 0.04
32 0.04
33 0.05
34 0.05
35 0.06
36 0.06
37 0.06
38 0.07
39 0.07
40 0.07
41 0.07
42 0.07
43 0.07
44 0.07
45 0.06
46 0.06
47 0.07
48 0.09
49 0.09
50 0.16
51 0.26
52 0.37
53 0.47
54 0.55
55 0.63
56 0.71
57 0.82
58 0.84
59 0.82
60 0.81
61 0.78
62 0.76
63 0.73
64 0.71
65 0.67
66 0.59
67 0.53
68 0.52
69 0.53
70 0.53
71 0.55
72 0.55
73 0.59