Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A319EAH9

Protein Details
Accession A0A319EAH9   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
66-93QQGSLAKSTKRRPKKIYMKSTIKCQTRKHydrophilic
NLS Segment(s)
PositionSequence
76-79RRPK
Subcellular Location(s) mito 18, nucl 8
Family & Domain DBs
Amino Acid Sequences MNRGPGRKEHRLSSDEISVNTLSCASCLTVLKLSRRWSTCDSSNQGVWISCKQTGMKFYVNLYAPQQGSLAKSTKRRPKKIYMKSTIKCQTRKYMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.45
3 0.41
4 0.37
5 0.3
6 0.27
7 0.22
8 0.19
9 0.11
10 0.09
11 0.09
12 0.07
13 0.09
14 0.09
15 0.11
16 0.15
17 0.18
18 0.22
19 0.26
20 0.3
21 0.34
22 0.35
23 0.38
24 0.38
25 0.4
26 0.41
27 0.43
28 0.42
29 0.39
30 0.37
31 0.33
32 0.29
33 0.25
34 0.21
35 0.17
36 0.14
37 0.12
38 0.13
39 0.13
40 0.15
41 0.17
42 0.19
43 0.2
44 0.19
45 0.19
46 0.23
47 0.23
48 0.22
49 0.21
50 0.22
51 0.2
52 0.19
53 0.19
54 0.15
55 0.15
56 0.17
57 0.2
58 0.2
59 0.28
60 0.36
61 0.46
62 0.56
63 0.64
64 0.68
65 0.75
66 0.82
67 0.85
68 0.87
69 0.87
70 0.87
71 0.82
72 0.85
73 0.83
74 0.81
75 0.77
76 0.72