Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A318ZAC3

Protein Details
Accession A0A318ZAC3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
15-37AVARNDLRRRFRRRDSVARRLGHBasic
NLS Segment(s)
PositionSequence
22-38RRRFRRRDSVARRLGHK
Subcellular Location(s) extr 23, plas 1, pero 1, E.R. 1, golg 1
Family & Domain DBs
Amino Acid Sequences MDITLVTLIALVCAAVARNDLRRRFRRRDSVARRLGHKAQRRDAFCVLHAGDNWNPQEVKDLFQCSVNLMDGYDRGNTGNKASCNMFRYLQNYGNTHSRGGIYEKVSQVLDVICFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.06
4 0.09
5 0.17
6 0.24
7 0.32
8 0.41
9 0.51
10 0.6
11 0.67
12 0.74
13 0.77
14 0.79
15 0.83
16 0.83
17 0.84
18 0.84
19 0.78
20 0.73
21 0.68
22 0.67
23 0.65
24 0.63
25 0.6
26 0.6
27 0.63
28 0.62
29 0.61
30 0.57
31 0.49
32 0.41
33 0.38
34 0.3
35 0.24
36 0.21
37 0.19
38 0.17
39 0.19
40 0.19
41 0.16
42 0.15
43 0.14
44 0.2
45 0.17
46 0.18
47 0.16
48 0.18
49 0.17
50 0.18
51 0.18
52 0.13
53 0.13
54 0.12
55 0.09
56 0.08
57 0.08
58 0.07
59 0.08
60 0.07
61 0.07
62 0.07
63 0.1
64 0.1
65 0.12
66 0.16
67 0.16
68 0.18
69 0.2
70 0.23
71 0.24
72 0.27
73 0.26
74 0.25
75 0.28
76 0.31
77 0.34
78 0.35
79 0.33
80 0.35
81 0.39
82 0.38
83 0.35
84 0.31
85 0.26
86 0.23
87 0.26
88 0.27
89 0.24
90 0.28
91 0.29
92 0.3
93 0.29
94 0.27
95 0.24
96 0.2