Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A8NBJ4

Protein Details
Accession A8NBJ4    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
197-228PPTAPRAVPPRRPRIRKGPKRLQKKAVTVEDLHydrophilic
NLS Segment(s)
PositionSequence
200-221APRAVPPRRPRIRKGPKRLQKK
Subcellular Location(s) nucl 10, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
KEGG cci:CC1G_02454  -  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
Amino Acid Sequences MNGPDRRHNIYHRTKRQLVGHQVPPAWRPNVMQAAKRAAEDAGSRILISKLPIDVNEQEVEELFKKTVGPVRESFLVYNSQGKSKGMAMVWFVRSGDAAIARAKYDGKIVDGRRPIKIEIIVDGVPGSASTSQVGPAAPAAPPSLLDRMGIKPTAAGPKATSLVQRTNPPGHPLPNQPLVTKLQAQAAARIASGAPPPTAPRAVPPRRPRIRKGPKRLQKKAVTVEDLDKEMEDYRAAIPENGFAMT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.78
3 0.79
4 0.78
5 0.77
6 0.75
7 0.71
8 0.67
9 0.64
10 0.6
11 0.55
12 0.52
13 0.43
14 0.36
15 0.3
16 0.32
17 0.39
18 0.4
19 0.4
20 0.39
21 0.45
22 0.44
23 0.43
24 0.36
25 0.27
26 0.25
27 0.22
28 0.2
29 0.16
30 0.15
31 0.14
32 0.14
33 0.15
34 0.14
35 0.14
36 0.13
37 0.12
38 0.13
39 0.13
40 0.17
41 0.17
42 0.19
43 0.19
44 0.17
45 0.15
46 0.15
47 0.17
48 0.13
49 0.13
50 0.11
51 0.1
52 0.1
53 0.12
54 0.17
55 0.17
56 0.2
57 0.21
58 0.24
59 0.27
60 0.28
61 0.26
62 0.22
63 0.23
64 0.19
65 0.24
66 0.21
67 0.2
68 0.2
69 0.2
70 0.2
71 0.18
72 0.2
73 0.15
74 0.15
75 0.15
76 0.18
77 0.18
78 0.17
79 0.16
80 0.13
81 0.13
82 0.12
83 0.1
84 0.07
85 0.07
86 0.08
87 0.08
88 0.08
89 0.09
90 0.09
91 0.09
92 0.1
93 0.1
94 0.1
95 0.17
96 0.18
97 0.23
98 0.29
99 0.3
100 0.3
101 0.32
102 0.3
103 0.26
104 0.26
105 0.2
106 0.15
107 0.16
108 0.14
109 0.12
110 0.11
111 0.09
112 0.07
113 0.06
114 0.06
115 0.03
116 0.04
117 0.04
118 0.04
119 0.05
120 0.06
121 0.06
122 0.05
123 0.05
124 0.06
125 0.05
126 0.06
127 0.06
128 0.05
129 0.06
130 0.08
131 0.09
132 0.08
133 0.09
134 0.1
135 0.12
136 0.14
137 0.13
138 0.12
139 0.11
140 0.13
141 0.19
142 0.17
143 0.16
144 0.15
145 0.17
146 0.18
147 0.19
148 0.19
149 0.16
150 0.21
151 0.23
152 0.27
153 0.29
154 0.33
155 0.33
156 0.36
157 0.36
158 0.35
159 0.36
160 0.37
161 0.39
162 0.41
163 0.41
164 0.36
165 0.36
166 0.35
167 0.34
168 0.31
169 0.27
170 0.23
171 0.25
172 0.25
173 0.25
174 0.25
175 0.22
176 0.19
177 0.18
178 0.15
179 0.13
180 0.14
181 0.13
182 0.1
183 0.11
184 0.13
185 0.16
186 0.18
187 0.16
188 0.22
189 0.31
190 0.39
191 0.48
192 0.56
193 0.63
194 0.72
195 0.79
196 0.8
197 0.81
198 0.84
199 0.85
200 0.87
201 0.87
202 0.86
203 0.9
204 0.92
205 0.91
206 0.89
207 0.87
208 0.85
209 0.82
210 0.76
211 0.68
212 0.64
213 0.57
214 0.5
215 0.41
216 0.31
217 0.25
218 0.22
219 0.19
220 0.14
221 0.12
222 0.12
223 0.15
224 0.16
225 0.16
226 0.16
227 0.17