Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A318ZM88

Protein Details
Accession A0A318ZM88    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
22-48SKPLRLNLPKRPPARRPPKSARRSSSRHydrophilic
NLS Segment(s)
PositionSequence
24-45PLRLNLPKRPPARRPPKSARRS
Subcellular Location(s) mito 11.5, nucl 10, cyto_mito 8.666, cyto_nucl 8.333, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSISQCCLHGFRWDGTPTGRTSKPLRLNLPKRPPARRPPKSARRSSSRAFSGAEILDFDEIAQHRFEKLDLPGFLQRNASPRLSMSRAGCGPDYSRVRAVGHCSGGLYVDRSFFASDDGGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.32
4 0.29
5 0.31
6 0.3
7 0.29
8 0.32
9 0.39
10 0.46
11 0.5
12 0.56
13 0.6
14 0.67
15 0.73
16 0.79
17 0.78
18 0.77
19 0.78
20 0.77
21 0.77
22 0.81
23 0.78
24 0.78
25 0.8
26 0.84
27 0.85
28 0.86
29 0.82
30 0.79
31 0.77
32 0.7
33 0.67
34 0.58
35 0.5
36 0.42
37 0.35
38 0.29
39 0.23
40 0.19
41 0.12
42 0.1
43 0.08
44 0.07
45 0.06
46 0.06
47 0.06
48 0.07
49 0.07
50 0.07
51 0.07
52 0.07
53 0.08
54 0.08
55 0.1
56 0.13
57 0.13
58 0.16
59 0.21
60 0.22
61 0.23
62 0.22
63 0.22
64 0.22
65 0.25
66 0.22
67 0.18
68 0.18
69 0.22
70 0.23
71 0.26
72 0.23
73 0.25
74 0.26
75 0.27
76 0.27
77 0.23
78 0.22
79 0.27
80 0.29
81 0.27
82 0.28
83 0.28
84 0.29
85 0.3
86 0.34
87 0.31
88 0.29
89 0.26
90 0.24
91 0.22
92 0.22
93 0.21
94 0.17
95 0.13
96 0.12
97 0.13
98 0.14
99 0.15
100 0.13
101 0.14