Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A318ZQ86

Protein Details
Accession A0A318ZQ86   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
76-104GPSPESPQKTPPKKKKRVSKKAVPGKGNVHydrophilic
NLS Segment(s)
PositionSequence
72-101KRAGGPSPESPQKTPPKKKKRVSKKAVPGK
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 9, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MKWTPENMNVLWETLFETHDLTIDVDKMAATWPTPHPDDEKPTPRAIKERLEKFRRNLKNGGSSITFSMGTKRAGGPSPESPQKTPPKKKKRVSKKAVPGKGNVASEEKGSLDGDRQGGAGEQGSAGNVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.1
4 0.11
5 0.1
6 0.1
7 0.11
8 0.1
9 0.1
10 0.1
11 0.09
12 0.08
13 0.08
14 0.08
15 0.08
16 0.07
17 0.07
18 0.1
19 0.12
20 0.16
21 0.18
22 0.19
23 0.23
24 0.26
25 0.32
26 0.37
27 0.42
28 0.4
29 0.44
30 0.45
31 0.42
32 0.45
33 0.42
34 0.42
35 0.44
36 0.5
37 0.56
38 0.61
39 0.65
40 0.64
41 0.7
42 0.69
43 0.65
44 0.6
45 0.54
46 0.54
47 0.5
48 0.47
49 0.37
50 0.31
51 0.26
52 0.23
53 0.19
54 0.11
55 0.12
56 0.12
57 0.11
58 0.11
59 0.11
60 0.12
61 0.13
62 0.15
63 0.17
64 0.19
65 0.24
66 0.29
67 0.31
68 0.31
69 0.37
70 0.46
71 0.53
72 0.59
73 0.65
74 0.71
75 0.79
76 0.86
77 0.89
78 0.9
79 0.91
80 0.9
81 0.9
82 0.89
83 0.9
84 0.89
85 0.82
86 0.73
87 0.69
88 0.64
89 0.55
90 0.46
91 0.39
92 0.31
93 0.28
94 0.26
95 0.2
96 0.15
97 0.15
98 0.13
99 0.12
100 0.14
101 0.15
102 0.14
103 0.13
104 0.12
105 0.12
106 0.13
107 0.11
108 0.08
109 0.08
110 0.07