Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A318Z6C5

Protein Details
Accession A0A318Z6C5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
48-67ESSREKSKGYPNHNKPHPPLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, plas 6, E.R. 3, extr 2
Family & Domain DBs
Amino Acid Sequences MIAIQIARPTIRHFSVHRPRPDTRTSRFITSSCLFSAVVLPFVPPALESSREKSKGYPNHNKPHPPLCFHAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.47
3 0.55
4 0.58
5 0.59
6 0.61
7 0.63
8 0.68
9 0.64
10 0.59
11 0.59
12 0.54
13 0.52
14 0.49
15 0.44
16 0.42
17 0.36
18 0.32
19 0.24
20 0.22
21 0.18
22 0.16
23 0.18
24 0.11
25 0.11
26 0.09
27 0.08
28 0.07
29 0.07
30 0.07
31 0.04
32 0.06
33 0.08
34 0.12
35 0.14
36 0.19
37 0.27
38 0.3
39 0.3
40 0.32
41 0.39
42 0.45
43 0.53
44 0.59
45 0.61
46 0.69
47 0.76
48 0.8
49 0.77
50 0.78
51 0.74
52 0.68