Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A318YZ28

Protein Details
Accession A0A318YZ28   
Localization Confidence Low
Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
9-36ETLMTHAKSRSRSKPQKQTKHIIQKIFLHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 17, mito 5, pero 2, nucl 1, golg 1, vacu 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR015876  Acyl-CoA_DS  
IPR001199  Cyt_B5-like_heme/steroid-bd  
IPR036400  Cyt_B5-like_heme/steroid_sf  
IPR018506  Cyt_B5_heme-BS  
Gene Ontology GO:0016020  C:membrane  
GO:0020037  F:heme binding  
GO:0046872  F:metal ion binding  
GO:0016717  F:oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water  
Pfam View protein in Pfam  
PF00173  Cyt-b5  
PROSITE View protein in PROSITE  
PS00191  CYTOCHROME_B5_1  
PS50255  CYTOCHROME_B5_2  
CDD cd03505  Delta9-FADS-like  
Amino Acid Sequences MGLSDLELETLMTHAKSRSRSKPQKQTKHIIQKIFLRLIASKATFLATTNWLNVIFIIIIPTIGFWKARSVPLHTPTALWTVVYYFCTGFGISAGYHRLWSHSSYTASRPLKLFLALYGRGAREFIWAHMGWMIKKQDPETIRRVSISNRIKIRLWTYISHCIAGLGWGDWKGGLIYAGFVRLFVVQQLTFCINSIAHWIREQTYDNTRTPRNNTFAALITLGEGWHNFHHEFPSDYHCAVQWYQSLGLAGNLQRLHSNEIEKGLKQGKRALTVIAGVVHDVTEFIEHHPGGPIMIRGGIGKNATAMFNGGVYGRSRNWVLDEHRGAVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.18
3 0.26
4 0.35
5 0.45
6 0.54
7 0.65
8 0.74
9 0.82
10 0.88
11 0.91
12 0.92
13 0.92
14 0.92
15 0.92
16 0.88
17 0.84
18 0.78
19 0.76
20 0.74
21 0.66
22 0.56
23 0.48
24 0.42
25 0.38
26 0.38
27 0.3
28 0.23
29 0.21
30 0.21
31 0.18
32 0.18
33 0.18
34 0.17
35 0.18
36 0.18
37 0.19
38 0.17
39 0.17
40 0.16
41 0.14
42 0.09
43 0.07
44 0.08
45 0.06
46 0.06
47 0.06
48 0.06
49 0.07
50 0.07
51 0.08
52 0.07
53 0.13
54 0.16
55 0.21
56 0.23
57 0.28
58 0.35
59 0.39
60 0.43
61 0.38
62 0.36
63 0.32
64 0.33
65 0.26
66 0.19
67 0.15
68 0.12
69 0.13
70 0.13
71 0.12
72 0.09
73 0.09
74 0.1
75 0.1
76 0.08
77 0.07
78 0.07
79 0.06
80 0.08
81 0.1
82 0.09
83 0.11
84 0.11
85 0.12
86 0.13
87 0.15
88 0.17
89 0.18
90 0.21
91 0.22
92 0.25
93 0.32
94 0.32
95 0.32
96 0.3
97 0.28
98 0.26
99 0.25
100 0.22
101 0.15
102 0.18
103 0.16
104 0.17
105 0.18
106 0.17
107 0.16
108 0.16
109 0.14
110 0.13
111 0.13
112 0.12
113 0.14
114 0.14
115 0.14
116 0.16
117 0.17
118 0.14
119 0.18
120 0.2
121 0.17
122 0.19
123 0.19
124 0.23
125 0.24
126 0.29
127 0.3
128 0.31
129 0.29
130 0.29
131 0.29
132 0.26
133 0.33
134 0.35
135 0.35
136 0.34
137 0.36
138 0.36
139 0.37
140 0.38
141 0.34
142 0.3
143 0.27
144 0.29
145 0.35
146 0.34
147 0.32
148 0.29
149 0.23
150 0.2
151 0.18
152 0.13
153 0.05
154 0.05
155 0.05
156 0.05
157 0.05
158 0.05
159 0.04
160 0.04
161 0.04
162 0.03
163 0.04
164 0.04
165 0.05
166 0.05
167 0.05
168 0.06
169 0.06
170 0.06
171 0.05
172 0.07
173 0.06
174 0.06
175 0.08
176 0.09
177 0.09
178 0.09
179 0.09
180 0.07
181 0.08
182 0.14
183 0.14
184 0.13
185 0.14
186 0.15
187 0.16
188 0.18
189 0.2
190 0.18
191 0.24
192 0.27
193 0.29
194 0.33
195 0.35
196 0.37
197 0.4
198 0.42
199 0.39
200 0.36
201 0.35
202 0.32
203 0.3
204 0.27
205 0.22
206 0.16
207 0.12
208 0.11
209 0.09
210 0.07
211 0.06
212 0.07
213 0.07
214 0.1
215 0.1
216 0.11
217 0.13
218 0.14
219 0.16
220 0.16
221 0.22
222 0.21
223 0.21
224 0.21
225 0.19
226 0.21
227 0.19
228 0.2
229 0.16
230 0.16
231 0.16
232 0.16
233 0.16
234 0.13
235 0.13
236 0.13
237 0.12
238 0.14
239 0.14
240 0.14
241 0.15
242 0.17
243 0.2
244 0.21
245 0.23
246 0.2
247 0.25
248 0.27
249 0.25
250 0.3
251 0.34
252 0.33
253 0.33
254 0.38
255 0.37
256 0.39
257 0.4
258 0.35
259 0.29
260 0.28
261 0.27
262 0.21
263 0.17
264 0.12
265 0.12
266 0.1
267 0.08
268 0.07
269 0.06
270 0.06
271 0.07
272 0.08
273 0.13
274 0.13
275 0.14
276 0.16
277 0.16
278 0.15
279 0.16
280 0.15
281 0.1
282 0.11
283 0.11
284 0.11
285 0.12
286 0.15
287 0.14
288 0.13
289 0.14
290 0.15
291 0.15
292 0.14
293 0.14
294 0.11
295 0.1
296 0.11
297 0.09
298 0.1
299 0.11
300 0.15
301 0.15
302 0.18
303 0.2
304 0.2
305 0.23
306 0.28
307 0.31
308 0.38
309 0.4