Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A8N4N7

Protein Details
Accession A8N4N7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
95-118GGKAERVARKKERQQAIKDRNFMSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG cci:CC1G_06015  -  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MSLLQIARRTSLAAATCRRYSSTVSSGTTPGSGDSAAAKKPGQAAPKSSCPPETVLKGLNYLKGQPPVLALPDDQYPDWLWTVLSPKQYPDDGPGGKAERVARKKERQQAIKDRNFMSTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.33
3 0.35
4 0.35
5 0.36
6 0.34
7 0.33
8 0.33
9 0.33
10 0.32
11 0.32
12 0.32
13 0.31
14 0.3
15 0.26
16 0.2
17 0.15
18 0.11
19 0.09
20 0.07
21 0.09
22 0.11
23 0.11
24 0.13
25 0.12
26 0.13
27 0.17
28 0.2
29 0.23
30 0.23
31 0.28
32 0.31
33 0.38
34 0.39
35 0.37
36 0.34
37 0.3
38 0.31
39 0.29
40 0.26
41 0.2
42 0.21
43 0.2
44 0.22
45 0.21
46 0.21
47 0.18
48 0.17
49 0.18
50 0.18
51 0.18
52 0.14
53 0.15
54 0.13
55 0.13
56 0.12
57 0.1
58 0.09
59 0.1
60 0.12
61 0.1
62 0.11
63 0.11
64 0.11
65 0.11
66 0.1
67 0.08
68 0.09
69 0.13
70 0.15
71 0.19
72 0.18
73 0.2
74 0.22
75 0.24
76 0.23
77 0.23
78 0.28
79 0.24
80 0.24
81 0.27
82 0.27
83 0.26
84 0.29
85 0.3
86 0.33
87 0.38
88 0.46
89 0.51
90 0.58
91 0.67
92 0.74
93 0.79
94 0.78
95 0.82
96 0.84
97 0.86
98 0.85
99 0.82
100 0.74