Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A318ZIJ6

Protein Details
Accession A0A318ZIJ6    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
78-109KRLCDGCKPVRRKNRVYIICSKNPKHKQRQGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, mito_nucl 13.5, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MMSVRSLLGASTGALRQFLPSLSRKPAGLLSRSFSQLAKLPFSNGLRLLRSGKQTGVVSATLRQIEQVRGMKTRSSVKRLCDGCKPVRRKNRVYIICSKNPKHKQRQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.12
5 0.12
6 0.15
7 0.18
8 0.22
9 0.27
10 0.28
11 0.27
12 0.28
13 0.33
14 0.33
15 0.32
16 0.3
17 0.29
18 0.3
19 0.32
20 0.31
21 0.25
22 0.22
23 0.22
24 0.22
25 0.21
26 0.19
27 0.18
28 0.22
29 0.23
30 0.23
31 0.22
32 0.22
33 0.19
34 0.21
35 0.23
36 0.21
37 0.23
38 0.22
39 0.19
40 0.21
41 0.2
42 0.18
43 0.17
44 0.14
45 0.12
46 0.13
47 0.14
48 0.11
49 0.11
50 0.12
51 0.12
52 0.12
53 0.17
54 0.2
55 0.2
56 0.22
57 0.23
58 0.23
59 0.25
60 0.34
61 0.34
62 0.37
63 0.39
64 0.41
65 0.48
66 0.51
67 0.51
68 0.5
69 0.52
70 0.54
71 0.6
72 0.64
73 0.66
74 0.73
75 0.78
76 0.77
77 0.79
78 0.8
79 0.79
80 0.77
81 0.78
82 0.76
83 0.77
84 0.79
85 0.75
86 0.75
87 0.77
88 0.81
89 0.82