Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A318ZEV4

Protein Details
Accession A0A318ZEV4    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
51-74GKKTPYPDAKRQRATPKSKRDGELBasic
102-121RTNTAGSRGRRKQKRSFKLEHydrophilic
NLS Segment(s)
PositionSequence
24-27AGKP
97-117RSRKKRTNTAGSRGRRKQKRS
Subcellular Location(s) nucl 19, cyto_nucl 12.5, mito 4, cyto 4
Family & Domain DBs
Amino Acid Sequences MGHNVTEGAIVQHLAKLRSRRVAAGKPVPPPLRRGGLGAGTSSNQAEALHGKKTPYPDAKRQRATPKSKRDGELGLSDFADVDSSSDEDYVVGSASRSRKKRTNTAGSRGRRKQKRSFKLESDSGAIETGDEEDSLLIPGAEFLDGPRQSSSAGNVSESATDLTPNDAFLASGYTLQQQFAGADQFPIQGHASATNLPENFYSSVLPPASGLMHSQPGDTGHNPSTFWFNDTTLGYPPPVYHGLTDPDVQMGYSGDNTSNTQEQFDTLLRYDDDSLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.21
3 0.26
4 0.32
5 0.39
6 0.41
7 0.45
8 0.5
9 0.57
10 0.61
11 0.64
12 0.63
13 0.6
14 0.67
15 0.67
16 0.6
17 0.57
18 0.53
19 0.49
20 0.44
21 0.42
22 0.36
23 0.35
24 0.34
25 0.3
26 0.26
27 0.21
28 0.21
29 0.18
30 0.15
31 0.1
32 0.09
33 0.1
34 0.13
35 0.14
36 0.16
37 0.17
38 0.19
39 0.21
40 0.25
41 0.33
42 0.38
43 0.43
44 0.51
45 0.61
46 0.69
47 0.73
48 0.76
49 0.78
50 0.78
51 0.82
52 0.81
53 0.82
54 0.81
55 0.81
56 0.76
57 0.69
58 0.62
59 0.55
60 0.51
61 0.42
62 0.34
63 0.27
64 0.24
65 0.21
66 0.17
67 0.14
68 0.07
69 0.06
70 0.05
71 0.06
72 0.06
73 0.06
74 0.06
75 0.05
76 0.06
77 0.05
78 0.05
79 0.04
80 0.04
81 0.08
82 0.15
83 0.22
84 0.26
85 0.31
86 0.38
87 0.44
88 0.54
89 0.59
90 0.64
91 0.65
92 0.71
93 0.75
94 0.76
95 0.8
96 0.78
97 0.79
98 0.76
99 0.76
100 0.77
101 0.78
102 0.8
103 0.79
104 0.78
105 0.75
106 0.73
107 0.68
108 0.59
109 0.5
110 0.41
111 0.32
112 0.25
113 0.18
114 0.11
115 0.08
116 0.07
117 0.05
118 0.04
119 0.04
120 0.04
121 0.04
122 0.04
123 0.04
124 0.03
125 0.03
126 0.03
127 0.03
128 0.03
129 0.03
130 0.03
131 0.1
132 0.1
133 0.11
134 0.11
135 0.11
136 0.12
137 0.13
138 0.14
139 0.12
140 0.12
141 0.11
142 0.12
143 0.12
144 0.11
145 0.12
146 0.11
147 0.07
148 0.07
149 0.07
150 0.07
151 0.07
152 0.07
153 0.07
154 0.06
155 0.06
156 0.06
157 0.07
158 0.06
159 0.06
160 0.07
161 0.09
162 0.09
163 0.1
164 0.1
165 0.08
166 0.08
167 0.08
168 0.1
169 0.07
170 0.07
171 0.08
172 0.09
173 0.09
174 0.11
175 0.1
176 0.09
177 0.1
178 0.1
179 0.1
180 0.11
181 0.12
182 0.14
183 0.14
184 0.14
185 0.14
186 0.16
187 0.15
188 0.15
189 0.15
190 0.12
191 0.16
192 0.15
193 0.15
194 0.12
195 0.12
196 0.12
197 0.11
198 0.11
199 0.09
200 0.14
201 0.14
202 0.14
203 0.14
204 0.15
205 0.19
206 0.19
207 0.21
208 0.21
209 0.21
210 0.22
211 0.22
212 0.25
213 0.22
214 0.22
215 0.2
216 0.17
217 0.19
218 0.2
219 0.21
220 0.19
221 0.19
222 0.18
223 0.16
224 0.16
225 0.17
226 0.18
227 0.17
228 0.16
229 0.18
230 0.22
231 0.24
232 0.25
233 0.21
234 0.19
235 0.18
236 0.17
237 0.14
238 0.11
239 0.09
240 0.1
241 0.1
242 0.1
243 0.12
244 0.14
245 0.17
246 0.21
247 0.21
248 0.21
249 0.2
250 0.2
251 0.22
252 0.22
253 0.23
254 0.19
255 0.21
256 0.2
257 0.22