Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A318ZKA0

Protein Details
Accession A0A318ZKA0    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
84-108WPRSLPWSARRRRPRGSPGPWPATTHydrophilic
NLS Segment(s)
PositionSequence
93-99RRRRPRG
Subcellular Location(s) plas 7, mito 6, extr 5, cyto 4.5, cyto_nucl 4, nucl 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYAGIDGVLHLAEECRDAARVVHRALLSTLVIGVGTSFAFLVAMLYWTDDLDAVVASATGVTFYELWYQARRQLRRCSSSCSAWPRSLPWSARRRRPRGSPGPWPATTPFSPASR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.09
5 0.11
6 0.16
7 0.21
8 0.21
9 0.25
10 0.24
11 0.24
12 0.24
13 0.24
14 0.18
15 0.13
16 0.12
17 0.07
18 0.07
19 0.06
20 0.05
21 0.04
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.04
29 0.03
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.02
44 0.02
45 0.02
46 0.02
47 0.02
48 0.03
49 0.03
50 0.04
51 0.06
52 0.07
53 0.08
54 0.1
55 0.11
56 0.17
57 0.25
58 0.29
59 0.33
60 0.43
61 0.49
62 0.55
63 0.57
64 0.59
65 0.56
66 0.56
67 0.57
68 0.55
69 0.52
70 0.47
71 0.46
72 0.41
73 0.4
74 0.42
75 0.39
76 0.4
77 0.46
78 0.52
79 0.61
80 0.69
81 0.73
82 0.74
83 0.8
84 0.81
85 0.82
86 0.81
87 0.82
88 0.81
89 0.81
90 0.73
91 0.67
92 0.59
93 0.55
94 0.48
95 0.41