Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A318ZKH4

Protein Details
Accession A0A318ZKH4    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
4-23AAPRKKSKISHDPNNTNWSRHydrophilic
197-227PKQKSEIQASRKKKSKKRKKDEKQEEEDMEHBasic
NLS Segment(s)
PositionSequence
205-219ASRKKKSKKRKKDEK
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000467  G_patch_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
PROSITE View protein in PROSITE  
PS50174  G_PATCH  
Amino Acid Sequences MGLAAPRKKSKISHDPNNTNWSRSTTGFGHKILSSQGWTPGGFLGARNAAHADLFTTASASHIRVVVKDDTLGLGARPKRDALDEPTGLDAFRGLLGRLNGKSDAELGIEERKRENAKLARYAASRWQAVNFISGGYLVQEKTDVPASEQPTQTQSDTEKLNPNKGTLEAQIRPKTTEPLDFEALSIDRQGQHEGSPKQKSEIQASRKKKSKKRKKDEKQEEEDMEHKKKELRDTKDKSYSGSSEEVDTPKVNPMSSRERRPMGRHIFRSRHIAQKKRALLDEKSLNEVRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.78
3 0.79
4 0.83
5 0.75
6 0.66
7 0.58
8 0.53
9 0.46
10 0.39
11 0.38
12 0.32
13 0.38
14 0.4
15 0.38
16 0.36
17 0.33
18 0.33
19 0.3
20 0.28
21 0.22
22 0.19
23 0.23
24 0.21
25 0.21
26 0.21
27 0.19
28 0.18
29 0.16
30 0.14
31 0.14
32 0.15
33 0.15
34 0.15
35 0.15
36 0.14
37 0.14
38 0.13
39 0.1
40 0.09
41 0.09
42 0.08
43 0.08
44 0.08
45 0.09
46 0.1
47 0.1
48 0.1
49 0.12
50 0.12
51 0.13
52 0.17
53 0.17
54 0.17
55 0.16
56 0.15
57 0.13
58 0.13
59 0.13
60 0.09
61 0.13
62 0.15
63 0.17
64 0.18
65 0.18
66 0.18
67 0.21
68 0.25
69 0.25
70 0.3
71 0.29
72 0.29
73 0.3
74 0.29
75 0.25
76 0.21
77 0.15
78 0.07
79 0.08
80 0.07
81 0.06
82 0.08
83 0.09
84 0.13
85 0.13
86 0.15
87 0.15
88 0.14
89 0.15
90 0.13
91 0.12
92 0.09
93 0.09
94 0.08
95 0.14
96 0.15
97 0.16
98 0.16
99 0.19
100 0.21
101 0.21
102 0.28
103 0.27
104 0.31
105 0.36
106 0.38
107 0.38
108 0.37
109 0.37
110 0.36
111 0.34
112 0.3
113 0.24
114 0.23
115 0.21
116 0.2
117 0.2
118 0.13
119 0.09
120 0.08
121 0.07
122 0.06
123 0.05
124 0.06
125 0.05
126 0.05
127 0.05
128 0.05
129 0.06
130 0.08
131 0.08
132 0.09
133 0.14
134 0.17
135 0.21
136 0.22
137 0.21
138 0.21
139 0.23
140 0.21
141 0.18
142 0.16
143 0.14
144 0.16
145 0.18
146 0.24
147 0.23
148 0.29
149 0.28
150 0.28
151 0.26
152 0.26
153 0.25
154 0.2
155 0.24
156 0.22
157 0.29
158 0.32
159 0.32
160 0.33
161 0.32
162 0.32
163 0.28
164 0.3
165 0.26
166 0.27
167 0.28
168 0.26
169 0.25
170 0.23
171 0.22
172 0.17
173 0.13
174 0.09
175 0.09
176 0.1
177 0.11
178 0.1
179 0.12
180 0.2
181 0.23
182 0.3
183 0.33
184 0.33
185 0.34
186 0.36
187 0.37
188 0.38
189 0.43
190 0.46
191 0.51
192 0.58
193 0.64
194 0.7
195 0.77
196 0.77
197 0.8
198 0.82
199 0.84
200 0.87
201 0.9
202 0.93
203 0.95
204 0.97
205 0.96
206 0.92
207 0.89
208 0.81
209 0.73
210 0.67
211 0.62
212 0.55
213 0.46
214 0.39
215 0.35
216 0.36
217 0.43
218 0.47
219 0.49
220 0.55
221 0.62
222 0.7
223 0.74
224 0.71
225 0.64
226 0.6
227 0.53
228 0.45
229 0.41
230 0.33
231 0.27
232 0.3
233 0.28
234 0.25
235 0.24
236 0.21
237 0.24
238 0.25
239 0.22
240 0.21
241 0.25
242 0.34
243 0.41
244 0.49
245 0.5
246 0.55
247 0.62
248 0.65
249 0.7
250 0.7
251 0.72
252 0.73
253 0.76
254 0.76
255 0.74
256 0.77
257 0.71
258 0.71
259 0.7
260 0.7
261 0.69
262 0.72
263 0.76
264 0.73
265 0.75
266 0.7
267 0.65
268 0.65
269 0.65
270 0.57
271 0.56