Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A318Z2F9

Protein Details
Accession A0A318Z2F9    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
202-223RVLSKAAIKKRRSRLRKMGVVDHydrophilic
NLS Segment(s)
PositionSequence
206-218KAAIKKRRSRLRK
Subcellular Location(s) mito 14, nucl 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036882  Alba-like_dom_sf  
IPR014612  Pop7/Rpp20  
IPR020241  RNase_P/MRP_Pop7_fungi  
Gene Ontology GO:0005655  C:nucleolar ribonuclease P complex  
GO:0000172  C:ribonuclease MRP complex  
GO:0003676  F:nucleic acid binding  
GO:0001682  P:tRNA 5'-leader removal  
Pfam View protein in Pfam  
PF12328  Rpp20  
Amino Acid Sequences MPPQQSSSTTTTTSSSKLTFTKKNQNMTKLPTYAKVHKRPIPHPAPPTPYTGPSTPKTIYVSTSTPKMSVVTRVRKLLRQAEKRATAALHNNASSHKHRGRAGAGTGAGSQAELLAKVQEALRREEVHVKATGRAIGKAVAVGEYFRRPPTETEGYRVEVRTGGVMVVDDVEVDEEAKQRVLEQAEVWRREVESGVEEGSGRVLSKAAIKKRRSRLRKMGVVDGQGKEDEKVGDVEEEEEQEEGEGTGEAEEAEEEELPESRTRWVNMVDVVIGLKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.23
3 0.23
4 0.28
5 0.34
6 0.4
7 0.46
8 0.56
9 0.59
10 0.68
11 0.72
12 0.74
13 0.73
14 0.72
15 0.71
16 0.65
17 0.61
18 0.58
19 0.58
20 0.59
21 0.63
22 0.64
23 0.66
24 0.65
25 0.71
26 0.68
27 0.72
28 0.71
29 0.69
30 0.67
31 0.66
32 0.68
33 0.62
34 0.63
35 0.56
36 0.5
37 0.47
38 0.43
39 0.4
40 0.35
41 0.39
42 0.33
43 0.33
44 0.33
45 0.3
46 0.29
47 0.27
48 0.29
49 0.26
50 0.29
51 0.26
52 0.23
53 0.23
54 0.22
55 0.19
56 0.24
57 0.31
58 0.36
59 0.39
60 0.46
61 0.48
62 0.5
63 0.55
64 0.56
65 0.57
66 0.57
67 0.61
68 0.62
69 0.64
70 0.61
71 0.56
72 0.47
73 0.4
74 0.37
75 0.35
76 0.29
77 0.25
78 0.25
79 0.25
80 0.29
81 0.28
82 0.31
83 0.29
84 0.31
85 0.33
86 0.36
87 0.37
88 0.36
89 0.34
90 0.28
91 0.25
92 0.21
93 0.19
94 0.15
95 0.12
96 0.09
97 0.07
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.04
104 0.05
105 0.06
106 0.08
107 0.1
108 0.13
109 0.15
110 0.16
111 0.18
112 0.24
113 0.24
114 0.24
115 0.25
116 0.23
117 0.22
118 0.21
119 0.23
120 0.17
121 0.16
122 0.14
123 0.12
124 0.11
125 0.1
126 0.09
127 0.06
128 0.06
129 0.06
130 0.07
131 0.07
132 0.09
133 0.09
134 0.1
135 0.11
136 0.13
137 0.19
138 0.26
139 0.25
140 0.28
141 0.3
142 0.31
143 0.32
144 0.3
145 0.23
146 0.16
147 0.16
148 0.12
149 0.1
150 0.07
151 0.06
152 0.05
153 0.05
154 0.04
155 0.04
156 0.03
157 0.03
158 0.03
159 0.03
160 0.04
161 0.04
162 0.05
163 0.06
164 0.06
165 0.06
166 0.07
167 0.1
168 0.11
169 0.11
170 0.11
171 0.2
172 0.26
173 0.28
174 0.29
175 0.26
176 0.25
177 0.25
178 0.24
179 0.17
180 0.12
181 0.12
182 0.11
183 0.1
184 0.1
185 0.09
186 0.09
187 0.08
188 0.07
189 0.06
190 0.06
191 0.06
192 0.13
193 0.2
194 0.28
195 0.37
196 0.43
197 0.53
198 0.63
199 0.73
200 0.75
201 0.79
202 0.81
203 0.82
204 0.84
205 0.79
206 0.78
207 0.71
208 0.68
209 0.63
210 0.53
211 0.45
212 0.37
213 0.34
214 0.25
215 0.22
216 0.17
217 0.13
218 0.12
219 0.12
220 0.11
221 0.11
222 0.12
223 0.11
224 0.12
225 0.11
226 0.1
227 0.09
228 0.08
229 0.08
230 0.07
231 0.06
232 0.05
233 0.05
234 0.05
235 0.05
236 0.05
237 0.05
238 0.05
239 0.05
240 0.06
241 0.06
242 0.06
243 0.07
244 0.08
245 0.1
246 0.12
247 0.12
248 0.16
249 0.2
250 0.22
251 0.25
252 0.26
253 0.28
254 0.28
255 0.29
256 0.25
257 0.21