Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1C515

Protein Details
Accession A0A0D1C515   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
90-118ALKAQLRQKARCRKDRRKQLKSSDTQQDPHydrophilic
NLS Segment(s)
PositionSequence
77-108RVAKPKSKAQIKAALKAQLRQKARCRKDRRKQ
Subcellular Location(s) nucl 17.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
KEGG uma:UMAG_03343  -  
Amino Acid Sequences MARTKAVNKASASKKRKFAEERGVAHLLSLSQSIADAESQRQHDRIQATKAKMQAEHDKKLGQCQREKADASVARDRVAKPKSKAQIKAALKAQLRQKARCRKDRRKQLKSSDTQQDPLSPNNHKKSVSFALA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.66
3 0.73
4 0.7
5 0.69
6 0.69
7 0.71
8 0.67
9 0.65
10 0.63
11 0.53
12 0.46
13 0.37
14 0.26
15 0.18
16 0.14
17 0.07
18 0.05
19 0.06
20 0.06
21 0.06
22 0.07
23 0.07
24 0.09
25 0.13
26 0.16
27 0.18
28 0.19
29 0.19
30 0.23
31 0.25
32 0.27
33 0.31
34 0.34
35 0.35
36 0.37
37 0.4
38 0.38
39 0.35
40 0.36
41 0.38
42 0.38
43 0.38
44 0.36
45 0.36
46 0.34
47 0.41
48 0.41
49 0.36
50 0.34
51 0.36
52 0.38
53 0.39
54 0.4
55 0.32
56 0.35
57 0.32
58 0.33
59 0.33
60 0.3
61 0.27
62 0.29
63 0.29
64 0.29
65 0.31
66 0.33
67 0.31
68 0.38
69 0.46
70 0.51
71 0.55
72 0.52
73 0.58
74 0.54
75 0.57
76 0.53
77 0.52
78 0.46
79 0.46
80 0.48
81 0.46
82 0.48
83 0.49
84 0.54
85 0.58
86 0.66
87 0.72
88 0.76
89 0.79
90 0.85
91 0.9
92 0.91
93 0.91
94 0.92
95 0.92
96 0.92
97 0.89
98 0.86
99 0.85
100 0.78
101 0.7
102 0.62
103 0.57
104 0.49
105 0.47
106 0.44
107 0.43
108 0.48
109 0.53
110 0.56
111 0.51
112 0.49
113 0.52