Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A318Z649

Protein Details
Accession A0A318Z649    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
61-81NLPTNRARHCHRQRRSPSYYYHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 9, plas 6, E.R. 4, mito 3, golg 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAPIHLLQSRDDSNCPNSISGGGIAGIVLGTMAGTLLLLWLWKLCAMNHEMESEPDYGETNLPTNRARHCHRQRRSPSYYYVEKPRSSVRRPAKVYLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.26
4 0.23
5 0.21
6 0.2
7 0.16
8 0.13
9 0.09
10 0.07
11 0.07
12 0.06
13 0.05
14 0.03
15 0.03
16 0.02
17 0.02
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.03
29 0.04
30 0.05
31 0.05
32 0.07
33 0.09
34 0.11
35 0.11
36 0.12
37 0.12
38 0.12
39 0.14
40 0.12
41 0.1
42 0.09
43 0.09
44 0.08
45 0.08
46 0.08
47 0.09
48 0.09
49 0.11
50 0.13
51 0.15
52 0.19
53 0.25
54 0.3
55 0.39
56 0.5
57 0.58
58 0.64
59 0.72
60 0.78
61 0.82
62 0.84
63 0.77
64 0.73
65 0.7
66 0.69
67 0.64
68 0.64
69 0.61
70 0.55
71 0.54
72 0.56
73 0.58
74 0.56
75 0.6
76 0.6
77 0.64
78 0.68