Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A318Z4J0

Protein Details
Accession A0A318Z4J0    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
189-211GSSKAQGGKKKSKSKKKTGGDGDBasic
NLS Segment(s)
PositionSequence
182-206KKDAGGGGSSKAQGGKKKSKSKKKT
Subcellular Location(s) cyto_nucl 11.333, nucl 11, cyto 9.5, cyto_pero 7.166, pero 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006708  Pex19  
IPR038322  Pex19_C_sf  
Gene Ontology GO:0005777  C:peroxisome  
Pfam View protein in Pfam  
PF04614  Pex19  
Amino Acid Sequences MSSSNPNPPASQSEHVTSPATNNPSTNPAESESRSATTATNTTTPQRPQPAQVDDEDSDFDELDDVLDNFNKPPPASAPAQTTDAPTEDVDLDEEAFLRQLEKDMASLMGAGGSGADNTTTTGASAGIPDGLGDGEEALEKDAEMFAKYLEESGVSAEDLLKQLVGDLIKGGGDGGAADNGKKDAGGGGSSKAQGGKKKSKSKKKTGGDGDAAAAGEASGSTVKTTASAAAAAAATTPETFNDTIQRTIERMKESGDKATAAAEEEDADADDLVAQLIKAIEAGGAGGDGNEADLTKMFMGMMEQLSNKEILYEPMKELDAKFGPWIAENKASGKVSGDELARYEKQAGVVAQIVAKFEEKGYTDEDPKCREYVWEKMQEMQGCGNPPDELISAPMMEDLMGGGGGAGAPDCPQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.37
3 0.36
4 0.31
5 0.28
6 0.31
7 0.31
8 0.29
9 0.28
10 0.28
11 0.33
12 0.35
13 0.33
14 0.29
15 0.28
16 0.32
17 0.33
18 0.35
19 0.32
20 0.3
21 0.29
22 0.28
23 0.25
24 0.23
25 0.24
26 0.22
27 0.22
28 0.23
29 0.27
30 0.33
31 0.36
32 0.39
33 0.45
34 0.45
35 0.48
36 0.54
37 0.54
38 0.5
39 0.49
40 0.47
41 0.4
42 0.39
43 0.33
44 0.26
45 0.21
46 0.18
47 0.16
48 0.1
49 0.09
50 0.08
51 0.08
52 0.07
53 0.08
54 0.09
55 0.1
56 0.11
57 0.14
58 0.16
59 0.15
60 0.17
61 0.19
62 0.22
63 0.25
64 0.28
65 0.29
66 0.29
67 0.33
68 0.31
69 0.3
70 0.27
71 0.24
72 0.22
73 0.17
74 0.16
75 0.13
76 0.13
77 0.12
78 0.1
79 0.1
80 0.08
81 0.08
82 0.07
83 0.07
84 0.06
85 0.06
86 0.06
87 0.08
88 0.09
89 0.09
90 0.1
91 0.1
92 0.1
93 0.09
94 0.09
95 0.07
96 0.05
97 0.05
98 0.04
99 0.04
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.04
106 0.05
107 0.05
108 0.05
109 0.05
110 0.06
111 0.06
112 0.06
113 0.06
114 0.05
115 0.05
116 0.05
117 0.05
118 0.04
119 0.04
120 0.03
121 0.03
122 0.03
123 0.04
124 0.04
125 0.04
126 0.04
127 0.04
128 0.05
129 0.05
130 0.06
131 0.06
132 0.06
133 0.05
134 0.06
135 0.06
136 0.06
137 0.06
138 0.06
139 0.05
140 0.06
141 0.06
142 0.05
143 0.05
144 0.05
145 0.06
146 0.07
147 0.06
148 0.06
149 0.05
150 0.05
151 0.07
152 0.06
153 0.05
154 0.05
155 0.05
156 0.05
157 0.05
158 0.05
159 0.03
160 0.03
161 0.03
162 0.03
163 0.04
164 0.05
165 0.05
166 0.05
167 0.06
168 0.06
169 0.05
170 0.05
171 0.04
172 0.05
173 0.06
174 0.06
175 0.07
176 0.09
177 0.1
178 0.1
179 0.12
180 0.14
181 0.18
182 0.24
183 0.33
184 0.4
185 0.51
186 0.6
187 0.68
188 0.75
189 0.81
190 0.85
191 0.81
192 0.82
193 0.77
194 0.74
195 0.65
196 0.56
197 0.46
198 0.36
199 0.29
200 0.19
201 0.13
202 0.06
203 0.04
204 0.03
205 0.03
206 0.03
207 0.03
208 0.03
209 0.03
210 0.03
211 0.04
212 0.05
213 0.05
214 0.05
215 0.05
216 0.05
217 0.05
218 0.05
219 0.05
220 0.05
221 0.04
222 0.04
223 0.04
224 0.04
225 0.04
226 0.06
227 0.07
228 0.07
229 0.13
230 0.14
231 0.15
232 0.16
233 0.17
234 0.15
235 0.19
236 0.22
237 0.19
238 0.18
239 0.2
240 0.25
241 0.25
242 0.27
243 0.25
244 0.21
245 0.19
246 0.19
247 0.17
248 0.12
249 0.11
250 0.08
251 0.07
252 0.07
253 0.07
254 0.06
255 0.06
256 0.05
257 0.04
258 0.04
259 0.03
260 0.03
261 0.03
262 0.03
263 0.03
264 0.04
265 0.04
266 0.03
267 0.04
268 0.04
269 0.03
270 0.04
271 0.03
272 0.03
273 0.03
274 0.03
275 0.03
276 0.02
277 0.03
278 0.03
279 0.03
280 0.03
281 0.04
282 0.05
283 0.05
284 0.05
285 0.05
286 0.05
287 0.05
288 0.07
289 0.08
290 0.08
291 0.09
292 0.1
293 0.11
294 0.11
295 0.1
296 0.09
297 0.09
298 0.11
299 0.14
300 0.15
301 0.16
302 0.17
303 0.18
304 0.18
305 0.18
306 0.21
307 0.19
308 0.18
309 0.18
310 0.17
311 0.17
312 0.18
313 0.21
314 0.18
315 0.21
316 0.22
317 0.23
318 0.27
319 0.27
320 0.25
321 0.24
322 0.22
323 0.19
324 0.22
325 0.21
326 0.16
327 0.17
328 0.23
329 0.22
330 0.22
331 0.21
332 0.19
333 0.19
334 0.21
335 0.2
336 0.16
337 0.17
338 0.17
339 0.17
340 0.16
341 0.16
342 0.14
343 0.14
344 0.13
345 0.11
346 0.14
347 0.14
348 0.15
349 0.19
350 0.22
351 0.29
352 0.34
353 0.4
354 0.41
355 0.42
356 0.41
357 0.37
358 0.39
359 0.37
360 0.4
361 0.44
362 0.48
363 0.47
364 0.51
365 0.56
366 0.54
367 0.51
368 0.45
369 0.39
370 0.34
371 0.34
372 0.3
373 0.24
374 0.21
375 0.22
376 0.18
377 0.15
378 0.13
379 0.14
380 0.12
381 0.12
382 0.12
383 0.09
384 0.08
385 0.08
386 0.06
387 0.05
388 0.04
389 0.04
390 0.04
391 0.03
392 0.03
393 0.04
394 0.04
395 0.03