Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A318ZQQ0

Protein Details
Accession A0A318ZQQ0    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
10-36GAPRVHRYSLRYRRAPNPHLRSCCRGFHydrophilic
573-604AEESKWEEKLRRDKKAKAKDKQAKPPSPPEMPBasic
NLS Segment(s)
PositionSequence
581-598KLRRDKKAKAKDKQAKPP
Subcellular Location(s) mito 19, nucl 4, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR003593  AAA+_ATPase  
IPR003959  ATPase_AAA_core  
IPR019489  Clp_ATPase_C  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
GO:0008233  F:peptidase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF07724  AAA_2  
PF10431  ClpB_D2-small  
Amino Acid Sequences MLRSPLRACGAPRVHRYSLRYRRAPNPHLRSCCRGFTDSSACHPTFSQFDRSDFTSQPWTGSYEAGLPTAGPLGSTPAFGAPRVTPRSLKHYLDQFVVGQDRAKRILSVAVFNHYQRVQELRRREEENAELLAKRARREALERHPVEDEYPGQQRTVALPPDADIVAPTTPPVELEDTPDSSPLQLEKSNILLLGPSGVGKTLMAKTLARILSVPFSISDCTPFTQAGYIGEDADVCVHRLLAAANYDVEQAERGIIVLDEVDKLAATKISHGKDVSGEGVQQALLKLIEGTTVQVQAKQEKSAPRVNNAPNTYPSNSPLGNSPFAPSGGGHAHQKGEVYNVRTDNILFIFSGAFVGLNKVVMDRISRGSIGFGQPVRTQSGSSERLRESGSANNQPLPILPGSEEEALYKKHLPFFSSASSASPNGEPVYFNALDLLNPSDLQNYGFIPELVGRVPVTAALSALTTPLLVRILTEPRNSLLAQYTTLFSLSGIELRFTTPALHKIAANAFTMGTGARALRTELETILSDAMFETPGSSVKFVLVTESVAERKEKPIYLSRGQGGRFHSLIAAEESKWEEKLRRDKKAKAKDKQAKPPSPPEMPSITNFKEYRTRAAGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.64
3 0.68
4 0.69
5 0.71
6 0.73
7 0.73
8 0.72
9 0.76
10 0.81
11 0.84
12 0.84
13 0.83
14 0.83
15 0.84
16 0.83
17 0.81
18 0.75
19 0.72
20 0.67
21 0.59
22 0.53
23 0.51
24 0.54
25 0.49
26 0.5
27 0.5
28 0.45
29 0.43
30 0.4
31 0.36
32 0.33
33 0.34
34 0.37
35 0.32
36 0.34
37 0.37
38 0.41
39 0.42
40 0.37
41 0.37
42 0.36
43 0.34
44 0.33
45 0.3
46 0.29
47 0.25
48 0.24
49 0.21
50 0.17
51 0.17
52 0.16
53 0.15
54 0.12
55 0.11
56 0.12
57 0.11
58 0.07
59 0.07
60 0.11
61 0.11
62 0.12
63 0.12
64 0.14
65 0.15
66 0.15
67 0.18
68 0.16
69 0.24
70 0.29
71 0.32
72 0.33
73 0.36
74 0.44
75 0.48
76 0.49
77 0.47
78 0.5
79 0.5
80 0.47
81 0.45
82 0.37
83 0.34
84 0.33
85 0.27
86 0.23
87 0.24
88 0.25
89 0.25
90 0.25
91 0.22
92 0.2
93 0.26
94 0.23
95 0.25
96 0.24
97 0.26
98 0.27
99 0.27
100 0.31
101 0.26
102 0.25
103 0.21
104 0.27
105 0.3
106 0.35
107 0.44
108 0.46
109 0.51
110 0.54
111 0.55
112 0.53
113 0.49
114 0.45
115 0.4
116 0.34
117 0.29
118 0.26
119 0.28
120 0.24
121 0.22
122 0.23
123 0.22
124 0.24
125 0.3
126 0.37
127 0.43
128 0.52
129 0.51
130 0.5
131 0.49
132 0.46
133 0.41
134 0.35
135 0.27
136 0.21
137 0.25
138 0.23
139 0.21
140 0.21
141 0.21
142 0.22
143 0.25
144 0.23
145 0.18
146 0.18
147 0.18
148 0.19
149 0.18
150 0.15
151 0.09
152 0.09
153 0.09
154 0.09
155 0.08
156 0.06
157 0.06
158 0.07
159 0.08
160 0.1
161 0.1
162 0.15
163 0.18
164 0.2
165 0.2
166 0.21
167 0.19
168 0.16
169 0.16
170 0.12
171 0.12
172 0.12
173 0.13
174 0.13
175 0.14
176 0.15
177 0.14
178 0.13
179 0.1
180 0.08
181 0.08
182 0.06
183 0.05
184 0.05
185 0.05
186 0.05
187 0.05
188 0.08
189 0.08
190 0.09
191 0.11
192 0.11
193 0.11
194 0.18
195 0.18
196 0.16
197 0.15
198 0.15
199 0.16
200 0.16
201 0.15
202 0.09
203 0.1
204 0.11
205 0.1
206 0.12
207 0.11
208 0.12
209 0.12
210 0.12
211 0.11
212 0.11
213 0.11
214 0.1
215 0.11
216 0.1
217 0.09
218 0.09
219 0.09
220 0.08
221 0.09
222 0.08
223 0.06
224 0.06
225 0.05
226 0.05
227 0.06
228 0.06
229 0.06
230 0.07
231 0.07
232 0.07
233 0.08
234 0.08
235 0.08
236 0.07
237 0.06
238 0.05
239 0.05
240 0.04
241 0.04
242 0.04
243 0.04
244 0.04
245 0.03
246 0.04
247 0.04
248 0.04
249 0.04
250 0.03
251 0.04
252 0.04
253 0.06
254 0.05
255 0.09
256 0.15
257 0.16
258 0.19
259 0.19
260 0.19
261 0.18
262 0.19
263 0.16
264 0.11
265 0.1
266 0.08
267 0.08
268 0.08
269 0.07
270 0.06
271 0.05
272 0.05
273 0.04
274 0.04
275 0.04
276 0.05
277 0.04
278 0.05
279 0.05
280 0.08
281 0.08
282 0.1
283 0.11
284 0.15
285 0.16
286 0.16
287 0.19
288 0.21
289 0.25
290 0.3
291 0.31
292 0.29
293 0.36
294 0.38
295 0.41
296 0.39
297 0.37
298 0.33
299 0.35
300 0.34
301 0.28
302 0.26
303 0.22
304 0.2
305 0.19
306 0.19
307 0.19
308 0.18
309 0.17
310 0.17
311 0.14
312 0.14
313 0.14
314 0.1
315 0.1
316 0.1
317 0.11
318 0.11
319 0.12
320 0.12
321 0.12
322 0.13
323 0.1
324 0.13
325 0.15
326 0.16
327 0.19
328 0.19
329 0.19
330 0.19
331 0.19
332 0.16
333 0.13
334 0.11
335 0.07
336 0.07
337 0.06
338 0.06
339 0.06
340 0.04
341 0.04
342 0.03
343 0.05
344 0.04
345 0.05
346 0.05
347 0.05
348 0.05
349 0.06
350 0.07
351 0.07
352 0.09
353 0.1
354 0.1
355 0.1
356 0.11
357 0.13
358 0.13
359 0.14
360 0.13
361 0.15
362 0.17
363 0.18
364 0.19
365 0.18
366 0.17
367 0.15
368 0.22
369 0.25
370 0.25
371 0.28
372 0.26
373 0.28
374 0.28
375 0.28
376 0.22
377 0.23
378 0.27
379 0.29
380 0.3
381 0.3
382 0.29
383 0.28
384 0.26
385 0.22
386 0.16
387 0.11
388 0.1
389 0.09
390 0.12
391 0.12
392 0.12
393 0.1
394 0.12
395 0.13
396 0.14
397 0.17
398 0.16
399 0.21
400 0.22
401 0.22
402 0.23
403 0.26
404 0.26
405 0.25
406 0.24
407 0.2
408 0.21
409 0.2
410 0.19
411 0.15
412 0.14
413 0.12
414 0.12
415 0.11
416 0.11
417 0.17
418 0.15
419 0.15
420 0.15
421 0.14
422 0.13
423 0.14
424 0.15
425 0.09
426 0.09
427 0.09
428 0.09
429 0.09
430 0.1
431 0.1
432 0.08
433 0.09
434 0.09
435 0.09
436 0.08
437 0.09
438 0.09
439 0.08
440 0.09
441 0.08
442 0.08
443 0.08
444 0.08
445 0.08
446 0.07
447 0.06
448 0.06
449 0.06
450 0.06
451 0.06
452 0.05
453 0.05
454 0.04
455 0.05
456 0.06
457 0.05
458 0.06
459 0.1
460 0.16
461 0.2
462 0.21
463 0.22
464 0.22
465 0.25
466 0.24
467 0.22
468 0.2
469 0.18
470 0.18
471 0.18
472 0.17
473 0.15
474 0.15
475 0.14
476 0.09
477 0.1
478 0.09
479 0.11
480 0.1
481 0.11
482 0.11
483 0.12
484 0.12
485 0.11
486 0.14
487 0.14
488 0.18
489 0.21
490 0.22
491 0.21
492 0.24
493 0.28
494 0.27
495 0.25
496 0.21
497 0.18
498 0.16
499 0.16
500 0.13
501 0.09
502 0.08
503 0.07
504 0.07
505 0.08
506 0.09
507 0.11
508 0.13
509 0.14
510 0.13
511 0.15
512 0.15
513 0.15
514 0.15
515 0.12
516 0.11
517 0.1
518 0.1
519 0.08
520 0.07
521 0.07
522 0.07
523 0.1
524 0.11
525 0.11
526 0.11
527 0.12
528 0.13
529 0.12
530 0.14
531 0.12
532 0.11
533 0.12
534 0.15
535 0.16
536 0.16
537 0.19
538 0.18
539 0.23
540 0.27
541 0.28
542 0.3
543 0.38
544 0.44
545 0.47
546 0.51
547 0.52
548 0.52
549 0.52
550 0.51
551 0.46
552 0.44
553 0.39
554 0.33
555 0.29
556 0.24
557 0.24
558 0.24
559 0.22
560 0.16
561 0.19
562 0.22
563 0.22
564 0.23
565 0.25
566 0.26
567 0.33
568 0.44
569 0.51
570 0.58
571 0.65
572 0.73
573 0.8
574 0.86
575 0.87
576 0.86
577 0.89
578 0.88
579 0.91
580 0.92
581 0.92
582 0.9
583 0.87
584 0.87
585 0.84
586 0.8
587 0.72
588 0.66
589 0.61
590 0.55
591 0.51
592 0.49
593 0.44
594 0.46
595 0.44
596 0.43
597 0.46
598 0.46
599 0.5