Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A318Z272

Protein Details
Accession A0A318Z272    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
50-93RSPASLSRSPRHRRSRTRTRSPSRTRSRSPYRDHRGYKRRRDDDBasic
152-176SDESDRRREKRARTRSRSPFREVRKBasic
NLS Segment(s)
PositionSequence
49-90PRSPASLSRSPRHRRSRTRTRSPSRTRSRSPYRDHRGYKRRR
157-178RRREKRARTRSRSPFREVRKPK
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MASLRSRSPSIPSEGEIIESGSETKATTAQLPLNGNRVDRPTRASSPAPRSPASLSRSPRHRRSRTRTRSPSRTRSRSPYRDHRGYKRRRDDDYDRDYDYDDRQYRYESSRRGGPRYDDSRYTGRGGQSHRRARPYYDYDREENFGQGLRYSDESDRRREKRARTRSRSPFREVRKPKQYSGDEWETQRGDSVASRDHRRKASIEQCSKLSKLLVFALKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.25
4 0.21
5 0.15
6 0.13
7 0.12
8 0.09
9 0.09
10 0.08
11 0.08
12 0.09
13 0.1
14 0.12
15 0.14
16 0.16
17 0.21
18 0.25
19 0.26
20 0.3
21 0.31
22 0.3
23 0.29
24 0.32
25 0.32
26 0.3
27 0.34
28 0.34
29 0.36
30 0.4
31 0.43
32 0.46
33 0.51
34 0.55
35 0.54
36 0.48
37 0.47
38 0.46
39 0.47
40 0.44
41 0.43
42 0.42
43 0.45
44 0.54
45 0.6
46 0.66
47 0.7
48 0.75
49 0.78
50 0.82
51 0.87
52 0.87
53 0.9
54 0.91
55 0.9
56 0.91
57 0.9
58 0.9
59 0.89
60 0.87
61 0.82
62 0.81
63 0.81
64 0.79
65 0.78
66 0.78
67 0.77
68 0.78
69 0.79
70 0.8
71 0.8
72 0.81
73 0.83
74 0.83
75 0.8
76 0.75
77 0.76
78 0.74
79 0.73
80 0.7
81 0.63
82 0.54
83 0.48
84 0.45
85 0.38
86 0.31
87 0.29
88 0.24
89 0.21
90 0.21
91 0.22
92 0.22
93 0.26
94 0.29
95 0.24
96 0.24
97 0.3
98 0.32
99 0.33
100 0.33
101 0.32
102 0.35
103 0.37
104 0.38
105 0.33
106 0.34
107 0.34
108 0.34
109 0.33
110 0.27
111 0.24
112 0.25
113 0.28
114 0.34
115 0.4
116 0.47
117 0.49
118 0.52
119 0.52
120 0.51
121 0.55
122 0.53
123 0.53
124 0.52
125 0.52
126 0.49
127 0.49
128 0.48
129 0.4
130 0.33
131 0.25
132 0.18
133 0.15
134 0.13
135 0.12
136 0.11
137 0.12
138 0.14
139 0.17
140 0.24
141 0.27
142 0.34
143 0.43
144 0.44
145 0.52
146 0.56
147 0.63
148 0.65
149 0.74
150 0.77
151 0.76
152 0.84
153 0.86
154 0.9
155 0.86
156 0.83
157 0.8
158 0.77
159 0.8
160 0.79
161 0.78
162 0.78
163 0.77
164 0.74
165 0.75
166 0.7
167 0.65
168 0.64
169 0.62
170 0.55
171 0.52
172 0.53
173 0.44
174 0.4
175 0.35
176 0.27
177 0.2
178 0.19
179 0.19
180 0.2
181 0.26
182 0.35
183 0.4
184 0.48
185 0.51
186 0.52
187 0.53
188 0.57
189 0.6
190 0.62
191 0.65
192 0.61
193 0.62
194 0.63
195 0.6
196 0.52
197 0.45
198 0.36
199 0.3
200 0.32