Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A318ZDB6

Protein Details
Accession A0A318ZDB6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
64-84EKDFGSKVRRRYRRRLEIMDFBasic
NLS Segment(s)
Subcellular Location(s) plas 6E.R. 6, cyto 4.5, extr 4, mito 3, cyto_nucl 3, pero 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR013785  Aldolase_TIM  
Amino Acid Sequences MDEGFTLSLLKRAKDNGFGVLVIPLDTWSLAWRLADLDNAYVFFITGIGNEIGFTDPVFRAKDEKDFGSKVRRRYRRRLEIMDFADIHPVLRILGIRLLFCVRIGMVPCFSTAIKAGMTHNLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.3
4 0.29
5 0.28
6 0.26
7 0.22
8 0.19
9 0.13
10 0.11
11 0.08
12 0.07
13 0.06
14 0.06
15 0.06
16 0.07
17 0.07
18 0.07
19 0.07
20 0.08
21 0.09
22 0.11
23 0.1
24 0.1
25 0.1
26 0.1
27 0.1
28 0.08
29 0.08
30 0.06
31 0.05
32 0.04
33 0.04
34 0.05
35 0.05
36 0.05
37 0.05
38 0.06
39 0.06
40 0.06
41 0.06
42 0.06
43 0.06
44 0.08
45 0.09
46 0.09
47 0.11
48 0.12
49 0.16
50 0.17
51 0.18
52 0.2
53 0.2
54 0.22
55 0.31
56 0.34
57 0.39
58 0.47
59 0.55
60 0.59
61 0.69
62 0.78
63 0.78
64 0.82
65 0.81
66 0.76
67 0.75
68 0.7
69 0.63
70 0.53
71 0.42
72 0.37
73 0.28
74 0.23
75 0.14
76 0.12
77 0.08
78 0.08
79 0.08
80 0.06
81 0.1
82 0.1
83 0.1
84 0.12
85 0.13
86 0.13
87 0.12
88 0.12
89 0.09
90 0.11
91 0.14
92 0.15
93 0.15
94 0.15
95 0.16
96 0.17
97 0.17
98 0.16
99 0.15
100 0.14
101 0.13
102 0.14
103 0.16