Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A318ZUL9

Protein Details
Accession A0A318ZUL9    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
27-48LRAVPKKKTSHMKKRHRQMAGKBasic
NLS Segment(s)
PositionSequence
31-46PKKKTSHMKKRHRQMA
Subcellular Location(s) mito 15, nucl 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MAQSLLRPAAFSLTFPGILTDLWESVLRAVPKKKTSHMKKRHRQMAGKALKDVRSLSTCSGCGQIKRAHVLCPHCVSSIKKEWGRKNAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.16
4 0.13
5 0.12
6 0.13
7 0.1
8 0.08
9 0.09
10 0.1
11 0.09
12 0.09
13 0.13
14 0.13
15 0.16
16 0.21
17 0.26
18 0.31
19 0.34
20 0.4
21 0.48
22 0.57
23 0.64
24 0.7
25 0.75
26 0.79
27 0.86
28 0.87
29 0.84
30 0.79
31 0.74
32 0.74
33 0.7
34 0.62
35 0.55
36 0.49
37 0.44
38 0.4
39 0.34
40 0.26
41 0.2
42 0.21
43 0.2
44 0.19
45 0.18
46 0.18
47 0.21
48 0.2
49 0.19
50 0.22
51 0.25
52 0.26
53 0.32
54 0.32
55 0.32
56 0.36
57 0.39
58 0.41
59 0.41
60 0.4
61 0.35
62 0.38
63 0.37
64 0.4
65 0.45
66 0.48
67 0.5
68 0.57
69 0.64