Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

D6RLU8

Protein Details
Accession D6RLU8    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
44-68SPRISYDARRPRKRHFPGCRSEVPEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 2
Family & Domain DBs
KEGG cci:CC1G_14454  -  
Amino Acid Sequences MGHMKEYLEWKQTFTISRKLDSKKVHQILNVGDGGTPWPDPFVSPRISYDARRPRKRHFPGCRSEVPEDIEIQDSGEKYFRAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.4
3 0.35
4 0.39
5 0.44
6 0.46
7 0.51
8 0.51
9 0.56
10 0.57
11 0.59
12 0.57
13 0.5
14 0.49
15 0.43
16 0.41
17 0.33
18 0.22
19 0.17
20 0.15
21 0.14
22 0.11
23 0.09
24 0.05
25 0.05
26 0.05
27 0.06
28 0.08
29 0.1
30 0.12
31 0.12
32 0.13
33 0.18
34 0.2
35 0.22
36 0.3
37 0.37
38 0.45
39 0.54
40 0.58
41 0.62
42 0.71
43 0.79
44 0.8
45 0.8
46 0.8
47 0.79
48 0.81
49 0.8
50 0.75
51 0.68
52 0.61
53 0.54
54 0.45
55 0.38
56 0.32
57 0.27
58 0.21
59 0.19
60 0.18
61 0.14
62 0.14
63 0.16