Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A318ZV21

Protein Details
Accession A0A318ZV21   
Localization Confidence Low
Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
226-248DRHQGRLDKARKRLDRFRRSAGEBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 8, cyto 7.5, nucl 5.5, extr 5, mito 3, golg 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR045242  Syntaxin  
IPR000727  T_SNARE_dom  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF05739  SNARE  
PROSITE View protein in PROSITE  
PS50192  T_SNARE  
CDD cd15859  SNARE_SYN8  
Amino Acid Sequences MPNPSQLLLLADHIKLSLLERQRAISLSLEPNSQDGEISRSLDSFKEGIEAIEAECEQLEVQNGRGDEDAADLRDQLTHLHAQYDDLSAQFHEITNAVATATATSSSSTPDLKQPVPQHPSSKSVRFMDAAAAAEAADADEDEHRRNLFRPYRDSPSPPPGSTNAGMDGLSNEQIYDHHAQVLRDQDEQLDRLGESIGRQHQLSIQIGDELEGHVALLDDLDGHVDRHQGRLDKARKRLDRFRRSAGENWSMMTIIGLIITLVILIVLLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.15
4 0.18
5 0.21
6 0.26
7 0.27
8 0.29
9 0.3
10 0.31
11 0.31
12 0.26
13 0.25
14 0.26
15 0.26
16 0.25
17 0.24
18 0.24
19 0.23
20 0.21
21 0.16
22 0.11
23 0.14
24 0.14
25 0.16
26 0.15
27 0.15
28 0.16
29 0.16
30 0.18
31 0.14
32 0.12
33 0.12
34 0.11
35 0.11
36 0.11
37 0.11
38 0.08
39 0.1
40 0.1
41 0.08
42 0.08
43 0.08
44 0.06
45 0.07
46 0.09
47 0.08
48 0.09
49 0.12
50 0.12
51 0.13
52 0.13
53 0.13
54 0.11
55 0.12
56 0.12
57 0.11
58 0.11
59 0.1
60 0.1
61 0.1
62 0.1
63 0.08
64 0.1
65 0.11
66 0.11
67 0.13
68 0.13
69 0.13
70 0.14
71 0.15
72 0.13
73 0.1
74 0.1
75 0.09
76 0.09
77 0.09
78 0.07
79 0.06
80 0.06
81 0.07
82 0.06
83 0.06
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.05
90 0.05
91 0.05
92 0.06
93 0.07
94 0.08
95 0.09
96 0.09
97 0.13
98 0.17
99 0.17
100 0.22
101 0.26
102 0.32
103 0.36
104 0.38
105 0.38
106 0.37
107 0.42
108 0.41
109 0.4
110 0.37
111 0.34
112 0.32
113 0.29
114 0.27
115 0.22
116 0.19
117 0.16
118 0.11
119 0.09
120 0.07
121 0.06
122 0.06
123 0.04
124 0.03
125 0.02
126 0.03
127 0.04
128 0.05
129 0.06
130 0.07
131 0.08
132 0.09
133 0.1
134 0.19
135 0.24
136 0.27
137 0.33
138 0.37
139 0.44
140 0.46
141 0.5
142 0.47
143 0.5
144 0.49
145 0.42
146 0.4
147 0.35
148 0.36
149 0.32
150 0.27
151 0.19
152 0.16
153 0.16
154 0.13
155 0.12
156 0.09
157 0.09
158 0.08
159 0.06
160 0.06
161 0.06
162 0.1
163 0.12
164 0.11
165 0.14
166 0.16
167 0.16
168 0.19
169 0.25
170 0.23
171 0.21
172 0.21
173 0.2
174 0.2
175 0.21
176 0.18
177 0.13
178 0.11
179 0.1
180 0.11
181 0.09
182 0.08
183 0.12
184 0.15
185 0.16
186 0.16
187 0.16
188 0.19
189 0.23
190 0.24
191 0.2
192 0.17
193 0.16
194 0.16
195 0.16
196 0.14
197 0.09
198 0.08
199 0.06
200 0.06
201 0.05
202 0.05
203 0.04
204 0.04
205 0.03
206 0.03
207 0.03
208 0.05
209 0.05
210 0.06
211 0.07
212 0.12
213 0.13
214 0.16
215 0.2
216 0.23
217 0.27
218 0.36
219 0.44
220 0.48
221 0.57
222 0.64
223 0.69
224 0.73
225 0.8
226 0.81
227 0.83
228 0.81
229 0.82
230 0.79
231 0.75
232 0.73
233 0.71
234 0.67
235 0.56
236 0.51
237 0.42
238 0.35
239 0.29
240 0.23
241 0.15
242 0.07
243 0.07
244 0.05
245 0.04
246 0.04
247 0.03
248 0.03
249 0.03
250 0.02