Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A318ZCC1

Protein Details
Accession A0A318ZCC1    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-44IDYVGKRKEGKREREREKKRKRERRREGERKRKNRRVWPTSCFBasic
NLS Segment(s)
PositionSequence
7-37KRKEGKREREREKKRKRERRREGERKRKNRR
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
Amino Acid Sequences MIDYVGKRKEGKREREREKKRKRERRREGERKRKNRRVWPTSCFSRVNPCNHLYGVWYFPATSASLLKCASASSRSPSSSCRKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.85
3 0.92
4 0.92
5 0.93
6 0.93
7 0.94
8 0.95
9 0.95
10 0.96
11 0.96
12 0.96
13 0.96
14 0.96
15 0.96
16 0.96
17 0.96
18 0.95
19 0.95
20 0.94
21 0.91
22 0.9
23 0.89
24 0.87
25 0.83
26 0.77
27 0.73
28 0.68
29 0.63
30 0.55
31 0.45
32 0.45
33 0.44
34 0.43
35 0.4
36 0.37
37 0.35
38 0.33
39 0.32
40 0.25
41 0.21
42 0.18
43 0.15
44 0.13
45 0.11
46 0.11
47 0.12
48 0.11
49 0.1
50 0.11
51 0.11
52 0.13
53 0.14
54 0.14
55 0.13
56 0.13
57 0.14
58 0.15
59 0.17
60 0.21
61 0.26
62 0.28
63 0.29
64 0.36