Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A318ZUW1

Protein Details
Accession A0A318ZUW1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
47-66CLTCGYCGNRRRTRGRRSRVHydrophilic
NLS Segment(s)
PositionSequence
57-65RRTRGRRSR
Subcellular Location(s) plas 14, vacu 5, mito 4, extr 1, pero 1, E.R. 1, golg 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGAVVSCITSVFHAIGACLMGIVNTIGSVCKAIIDGIVTLFDVIISCLTCGYCGNRRRTRGRRSRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.07
5 0.05
6 0.05
7 0.03
8 0.04
9 0.04
10 0.03
11 0.03
12 0.03
13 0.03
14 0.03
15 0.04
16 0.03
17 0.04
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.03
29 0.03
30 0.03
31 0.04
32 0.04
33 0.04
34 0.05
35 0.05
36 0.05
37 0.07
38 0.12
39 0.19
40 0.27
41 0.37
42 0.45
43 0.53
44 0.63
45 0.72
46 0.78