Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A8PIY7

Protein Details
Accession A8PIY7    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
92-113SSYGSPNKRAPKRKPKSAEFINHydrophilic
NLS Segment(s)
PositionSequence
98-107NKRAPKRKPK
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
KEGG cci:CC1G_13469  -  
Amino Acid Sequences MRICEQVQDADDDGLPLLMAISRLHRRLAALDQEPNPDWFVIPDDEVIARIVPVTATMPPSPAVTVSPRSGKTSPGTPRFRRTSQNTGKDASSYGSPNKRAPKRKPKSAEFINDSQEEADPKKQKGNDGASVPSAKALGKRKAVENPHTPGESAALVKAARNIVTLRPAGSAKAASNAEAGPSGSKRTSSGRGKAASTTSSVKKFPKDEGIVASQLTGVDPIDLSTPEGRKLFNELNLYSSTSTLPPKRTSMLRADVFGLETVSYRSTSTASTILASCHNKYQVAFST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.07
4 0.06
5 0.05
6 0.06
7 0.06
8 0.13
9 0.19
10 0.21
11 0.23
12 0.24
13 0.24
14 0.27
15 0.33
16 0.34
17 0.33
18 0.38
19 0.39
20 0.43
21 0.43
22 0.41
23 0.36
24 0.28
25 0.23
26 0.17
27 0.18
28 0.15
29 0.14
30 0.13
31 0.13
32 0.13
33 0.13
34 0.13
35 0.09
36 0.08
37 0.07
38 0.07
39 0.05
40 0.06
41 0.07
42 0.08
43 0.11
44 0.11
45 0.12
46 0.13
47 0.14
48 0.13
49 0.12
50 0.13
51 0.14
52 0.17
53 0.19
54 0.24
55 0.25
56 0.3
57 0.3
58 0.32
59 0.31
60 0.36
61 0.41
62 0.46
63 0.53
64 0.53
65 0.61
66 0.64
67 0.65
68 0.66
69 0.64
70 0.66
71 0.66
72 0.7
73 0.65
74 0.61
75 0.57
76 0.49
77 0.42
78 0.32
79 0.25
80 0.18
81 0.21
82 0.25
83 0.27
84 0.32
85 0.41
86 0.48
87 0.55
88 0.64
89 0.69
90 0.72
91 0.8
92 0.83
93 0.8
94 0.8
95 0.78
96 0.76
97 0.7
98 0.64
99 0.58
100 0.49
101 0.43
102 0.35
103 0.27
104 0.21
105 0.17
106 0.2
107 0.2
108 0.21
109 0.25
110 0.26
111 0.28
112 0.34
113 0.37
114 0.34
115 0.32
116 0.32
117 0.29
118 0.29
119 0.26
120 0.19
121 0.14
122 0.1
123 0.14
124 0.19
125 0.22
126 0.26
127 0.28
128 0.3
129 0.36
130 0.41
131 0.42
132 0.41
133 0.39
134 0.37
135 0.36
136 0.33
137 0.27
138 0.23
139 0.17
140 0.12
141 0.09
142 0.07
143 0.07
144 0.07
145 0.09
146 0.08
147 0.08
148 0.09
149 0.1
150 0.09
151 0.13
152 0.13
153 0.12
154 0.13
155 0.13
156 0.12
157 0.12
158 0.13
159 0.1
160 0.14
161 0.13
162 0.12
163 0.13
164 0.12
165 0.12
166 0.11
167 0.11
168 0.08
169 0.08
170 0.1
171 0.09
172 0.1
173 0.12
174 0.15
175 0.24
176 0.29
177 0.34
178 0.38
179 0.4
180 0.41
181 0.41
182 0.39
183 0.31
184 0.28
185 0.27
186 0.26
187 0.27
188 0.29
189 0.31
190 0.34
191 0.35
192 0.35
193 0.39
194 0.38
195 0.37
196 0.37
197 0.37
198 0.33
199 0.3
200 0.27
201 0.18
202 0.15
203 0.13
204 0.09
205 0.06
206 0.05
207 0.05
208 0.05
209 0.06
210 0.06
211 0.08
212 0.12
213 0.13
214 0.16
215 0.18
216 0.18
217 0.17
218 0.24
219 0.25
220 0.27
221 0.31
222 0.28
223 0.3
224 0.31
225 0.32
226 0.26
227 0.23
228 0.19
229 0.17
230 0.23
231 0.25
232 0.29
233 0.31
234 0.33
235 0.37
236 0.4
237 0.42
238 0.43
239 0.47
240 0.44
241 0.43
242 0.42
243 0.38
244 0.35
245 0.3
246 0.22
247 0.14
248 0.12
249 0.12
250 0.11
251 0.11
252 0.1
253 0.11
254 0.11
255 0.12
256 0.14
257 0.15
258 0.14
259 0.16
260 0.16
261 0.17
262 0.23
263 0.26
264 0.26
265 0.3
266 0.32
267 0.32
268 0.32