Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A318Z3R2

Protein Details
Accession A0A318Z3R2   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
83-106EAGRNPCRPSHRRPSPDRPWQVSTHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 16, plas 8, mito 2
Family & Domain DBs
Amino Acid Sequences MARSAQLWGICSVSVCFSLYGVSFSLSLCVCVCVPFRQHHPTGQTVQSYRDIGCRKSADMDARIFLSLSRLVAFTAEGKSFTEAGRNPCRPSHRRPSPDRPWQVST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.1
4 0.09
5 0.1
6 0.1
7 0.1
8 0.09
9 0.09
10 0.08
11 0.08
12 0.1
13 0.09
14 0.1
15 0.09
16 0.09
17 0.09
18 0.1
19 0.12
20 0.13
21 0.16
22 0.18
23 0.24
24 0.28
25 0.3
26 0.32
27 0.34
28 0.35
29 0.36
30 0.35
31 0.33
32 0.28
33 0.28
34 0.27
35 0.24
36 0.21
37 0.23
38 0.22
39 0.2
40 0.23
41 0.22
42 0.2
43 0.21
44 0.24
45 0.21
46 0.22
47 0.22
48 0.19
49 0.18
50 0.18
51 0.16
52 0.13
53 0.11
54 0.09
55 0.08
56 0.08
57 0.07
58 0.07
59 0.08
60 0.08
61 0.08
62 0.1
63 0.1
64 0.1
65 0.11
66 0.13
67 0.13
68 0.13
69 0.17
70 0.18
71 0.26
72 0.35
73 0.38
74 0.39
75 0.44
76 0.53
77 0.53
78 0.59
79 0.63
80 0.64
81 0.7
82 0.77
83 0.82
84 0.83
85 0.88
86 0.89