Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A318Z2X4

Protein Details
Accession A0A318Z2X4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
27-52IFQFSYRKKIHKKTGKPTKKLKYNSPHydrophilic
NLS Segment(s)
PositionSequence
33-47RKKIHKKTGKPTKKL
Subcellular Location(s) mito 8, plas 6, extr 5, cyto_mito 5, mito_nucl 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences SLFCCLIPSTFSPTSSLLPSLISLSLIFQFSYRKKIHKKTGKPTKKLKYNSPSDPLILVISWYILSLFFSHTTCGLCGAVCVCACCVGVLAAGEIFPLRHFHPISSPFLAVHCRLLSIHHFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.25
4 0.17
5 0.16
6 0.16
7 0.15
8 0.12
9 0.11
10 0.09
11 0.09
12 0.1
13 0.1
14 0.09
15 0.09
16 0.15
17 0.16
18 0.24
19 0.26
20 0.33
21 0.41
22 0.51
23 0.61
24 0.65
25 0.74
26 0.77
27 0.86
28 0.87
29 0.86
30 0.87
31 0.86
32 0.85
33 0.81
34 0.79
35 0.77
36 0.74
37 0.71
38 0.65
39 0.57
40 0.48
41 0.43
42 0.33
43 0.25
44 0.17
45 0.11
46 0.06
47 0.05
48 0.04
49 0.04
50 0.03
51 0.03
52 0.04
53 0.04
54 0.05
55 0.06
56 0.07
57 0.07
58 0.08
59 0.09
60 0.08
61 0.09
62 0.08
63 0.07
64 0.07
65 0.07
66 0.08
67 0.08
68 0.08
69 0.07
70 0.08
71 0.08
72 0.08
73 0.07
74 0.06
75 0.06
76 0.06
77 0.06
78 0.05
79 0.05
80 0.05
81 0.05
82 0.05
83 0.05
84 0.07
85 0.08
86 0.14
87 0.15
88 0.16
89 0.23
90 0.27
91 0.33
92 0.33
93 0.33
94 0.28
95 0.29
96 0.32
97 0.26
98 0.26
99 0.2
100 0.18
101 0.18
102 0.21