Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A318ZQ42

Protein Details
Accession A0A318ZQ42   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
56-76EEFHCRPPRSHPRQHRYVFSYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 15.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035994  Nucleoside_phosphorylase_sf  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0009116  P:nucleoside metabolic process  
Amino Acid Sequences MDDPSPPPHPKPNDDSHYSSSEDTNSPASISPTEITVAICCALPIESVAVRYTLDEEFHCRPPRSHPRQHRYVFSYGRIGEHKVVLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.63
3 0.58
4 0.54
5 0.5
6 0.44
7 0.35
8 0.31
9 0.25
10 0.21
11 0.18
12 0.15
13 0.14
14 0.13
15 0.13
16 0.11
17 0.12
18 0.11
19 0.1
20 0.1
21 0.1
22 0.09
23 0.08
24 0.08
25 0.06
26 0.06
27 0.05
28 0.05
29 0.04
30 0.04
31 0.04
32 0.05
33 0.05
34 0.06
35 0.06
36 0.06
37 0.06
38 0.06
39 0.08
40 0.07
41 0.08
42 0.08
43 0.13
44 0.17
45 0.24
46 0.3
47 0.29
48 0.3
49 0.39
50 0.5
51 0.54
52 0.61
53 0.66
54 0.69
55 0.78
56 0.82
57 0.8
58 0.74
59 0.74
60 0.67
61 0.6
62 0.58
63 0.49
64 0.48
65 0.42
66 0.4
67 0.34