Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A318ZNL7

Protein Details
Accession A0A318ZNL7   
Localization Confidence High
Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
8-35RPPTDTTSVKRKPPKLRRKPPPAEEAAPHydrophilic
161-205SSSPQPQPQRQPRRRAHPPVRDPSTASSYRQQRRRNQRGGNQELGHydrophilic
NLS Segment(s)
PositionSequence
17-29KRKPPKLRRKPPP
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MTDSAQDRPPTDTTSVKRKPPKLRRKPPPAEEAAPAEKTATDTEKKTSPAEDSPAENSAEKPAEKPASAEEPSSSTATEKQPESETPVPAQENSSGEPPPPPTEQPPPTEQSPAENSDEPEQQTNPSPPNDPSTPDAMAEENPRPAESPPASSFNDDDDASSSPQPQPQRQPRRRAHPPVRDPSTASSYRQQRRRNQRGGNQELGPLGGLDPGNLTQGAGQLVQNTAGKAVSSVGDTAGKALGGVLGGGQVQGQGQGQEKGGKEEQLRLRLDLNLDVEVQLKAKIHGDLTLQLLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.51
3 0.56
4 0.64
5 0.69
6 0.77
7 0.8
8 0.86
9 0.86
10 0.91
11 0.92
12 0.94
13 0.95
14 0.92
15 0.9
16 0.86
17 0.78
18 0.71
19 0.67
20 0.61
21 0.51
22 0.43
23 0.34
24 0.26
25 0.24
26 0.23
27 0.21
28 0.2
29 0.21
30 0.25
31 0.29
32 0.31
33 0.31
34 0.3
35 0.3
36 0.29
37 0.32
38 0.31
39 0.3
40 0.3
41 0.3
42 0.3
43 0.26
44 0.23
45 0.22
46 0.23
47 0.2
48 0.19
49 0.23
50 0.25
51 0.24
52 0.24
53 0.24
54 0.27
55 0.28
56 0.28
57 0.22
58 0.22
59 0.24
60 0.23
61 0.2
62 0.14
63 0.18
64 0.2
65 0.23
66 0.21
67 0.22
68 0.23
69 0.24
70 0.31
71 0.3
72 0.29
73 0.26
74 0.28
75 0.27
76 0.25
77 0.25
78 0.2
79 0.18
80 0.17
81 0.18
82 0.15
83 0.15
84 0.16
85 0.17
86 0.18
87 0.19
88 0.2
89 0.22
90 0.3
91 0.33
92 0.35
93 0.37
94 0.37
95 0.36
96 0.37
97 0.32
98 0.28
99 0.28
100 0.27
101 0.26
102 0.24
103 0.23
104 0.24
105 0.26
106 0.22
107 0.21
108 0.18
109 0.16
110 0.18
111 0.19
112 0.19
113 0.18
114 0.19
115 0.19
116 0.23
117 0.23
118 0.23
119 0.22
120 0.22
121 0.21
122 0.19
123 0.19
124 0.14
125 0.15
126 0.15
127 0.14
128 0.13
129 0.12
130 0.12
131 0.12
132 0.12
133 0.16
134 0.14
135 0.17
136 0.18
137 0.22
138 0.23
139 0.23
140 0.23
141 0.19
142 0.2
143 0.15
144 0.14
145 0.11
146 0.12
147 0.12
148 0.12
149 0.12
150 0.11
151 0.15
152 0.18
153 0.21
154 0.29
155 0.39
156 0.5
157 0.56
158 0.66
159 0.7
160 0.77
161 0.82
162 0.83
163 0.83
164 0.82
165 0.83
166 0.82
167 0.8
168 0.72
169 0.64
170 0.56
171 0.53
172 0.44
173 0.37
174 0.35
175 0.39
176 0.46
177 0.52
178 0.57
179 0.6
180 0.7
181 0.78
182 0.8
183 0.79
184 0.79
185 0.82
186 0.8
187 0.75
188 0.64
189 0.55
190 0.45
191 0.37
192 0.29
193 0.18
194 0.11
195 0.09
196 0.07
197 0.06
198 0.07
199 0.07
200 0.08
201 0.08
202 0.07
203 0.06
204 0.07
205 0.08
206 0.08
207 0.08
208 0.08
209 0.09
210 0.11
211 0.11
212 0.1
213 0.1
214 0.09
215 0.09
216 0.08
217 0.09
218 0.07
219 0.07
220 0.07
221 0.08
222 0.09
223 0.09
224 0.1
225 0.09
226 0.08
227 0.07
228 0.07
229 0.06
230 0.05
231 0.05
232 0.04
233 0.04
234 0.04
235 0.04
236 0.04
237 0.04
238 0.04
239 0.05
240 0.06
241 0.07
242 0.1
243 0.12
244 0.14
245 0.18
246 0.19
247 0.24
248 0.26
249 0.29
250 0.29
251 0.36
252 0.41
253 0.44
254 0.45
255 0.41
256 0.41
257 0.39
258 0.39
259 0.34
260 0.29
261 0.23
262 0.21
263 0.2
264 0.19
265 0.17
266 0.16
267 0.14
268 0.13
269 0.13
270 0.15
271 0.17
272 0.16
273 0.18
274 0.2
275 0.21